UniGene Name: sp_v3.0_unigene64339
Length: 240 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene64339
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Ketol-acid reductoisomerase, chloroplastic n=2 Tax=core eudicotyledons RepID=ILV5_SPIOL | - | - | 1.0e-21 | 83% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 75% |
Sma3 | Putative ketol-acid reductoisomerase | - | - | 2.178e-12 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ketol-acid reductoisomerase. | EC:1.1.1.86 | - | 1.284e-22 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Valine, leucine and isoleucine biosynthesis | 00290 | 1.284e-22 | % | |
Sma3 | Pantothenate and CoA biosynthesis | 00770 | 1.284e-22 | % | |
Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 1.284e-22 | % | |
Sma3 | Metabolic pathways | 01100 | 1.284e-22 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.284e-22 | % |
Source | Gene names |
---|---|
Sma3 | AAI1; AHRI; AT3G58610; At3g58610; CHLREDRAFT_140839; F14P22.200; GSVIVT00018719001; OJ1735_C10.18; OSJNBb0032K15.18; Os01g0652600; Os05g0573700; OsI_03093; OsI_21076; OsJ_02845; OsJ_19628; PGAAIR; PHYPADRAFT_110501; PHYPADRAFT_145519; POPTRDRAFT_817858; P |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | ketol-acid reductoisomerase activity | GO:0004455 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | isomerase activity | GO:0016853 | Molecular Function | 0.0 | - |
Sma3 | coenzyme binding | GO:0050662 | Molecular Function | 0.0 | - |
Sma3 | branched chain family amino acid biosynthetic process | GO:0009082 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Acetohydroxy acid isomeroreductase C-terminal | IPR000506 | - | 0.0 | - |
Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
Sma3 | Acetohydroxy acid isomeroreductase | IPR013023 | - | 0.0 | - |
Sma3 | Acetohydroxy acid isomeroreductase, catalytic | IPR013116 | - | 0.0 | - |
Sma3 | Dehydrogenase, multihelical | IPR013328 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Sma3 | Ketol-acid reductoisomerase | IPR016206 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G58610.1 | ketol-acid reductoisomerase chr3:21671561-21674639 FORWARD LENGTH=591 | 2.0e-26 | 81% |
RefSeq | Arabidopsis thaliana | NP_001190127.1 | ketol-acid reductoisomerase [Arabidopsis thaliana] | 3.0e-26 | 81% |
RefSeq | Populus trichocarpa | XP_002329780.1 | predicted protein [Populus trichocarpa] | 2.0e-27 | 83% |
![]() |
---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LR30
Fln msg: your sequence is shorter than subject: 63 - 467
Fln protein:
N
Protein Length:
64
Fln nts:
C
Fln Alignment:
G5KS2UX02HSITJ___NEIRSVVLAGRRLLRRMGYQHFPWVRLTKHECGKLANVFVQCGLLGTWVLFIHLLQVLFMWH
B8LR30_______________NEIRSVVLAGRRFVEKDGLPAFPMVRLTKRECGKLVNGFVQCGLLVTWVLFIHLLPV-FMWH
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain