UniGene Name: sp_v3.0_unigene64302
Length: 206 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene64302
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pfam11721, Malectin, Di-glucose binding within endoplasmic reticulum | - | - | 1.0e-18 | 49% |
FL-Next | sp=Probable LRR receptor-like serine/threonine-protein kinase At1g56130; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 67% |
Sma3 | Putative Receptor-like serine/threonine kinase(RFK1) | - | - | 2.138e-10 | - |
Source | Gene names |
---|---|
Sma3 | AT1G56145; At1g56140; At1g56145; F14G9.24; GSVIVT00031536001; GSVIVT00031537001; GSVIVT00031542001; GSVIVT00032664001; GSVIVT00035223001; GSVIVT00035559001; H0525G02.10; H0525G02.11; H0525G02.12; H0525G02.9; H0818E11.1; LRR-RLK; OJ1014_H11.14; OJ1014_H11. |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Transcription regulator LuxR, C-terminal | IPR000792 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
Sma3 | AUX/IAA protein | IPR003311 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Aux/IAA-ARF-dimerisation | IPR011525 | - | 0.0 | - |
Sma3 | SKG6/AXL2 alpha-helix transmembrane domain | IPR014805 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G56120.1 | Leucine-rich repeat transmembrane protein kinase chr1:20987288-20993072 REVERSE LENGTH=1047 | 3.0e-22 | 66% |
RefSeq | Arabidopsis thaliana | NP_176008.4 | Leucine-rich repeat transmembrane protein kinase [Arabidopsis thaliana] | 4.0e-22 | 66% |
RefSeq | Populus trichocarpa | XP_002309634.1 | predicted protein [Populus trichocarpa] | 6.0e-24 | 69% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: C0LGH2
Fln msg: Distance to subject end: 486 aas, your sequence is shorter than subject: 68 - 1032
Fln protein:
N
Protein Length:
69
Fln nts:
T
Fln Alignment:
G5KS2UX02J69I8___NPTYIATSQSQFTKTLDTELYQTARLSPSSLRYYGLGLENGPYAVNLQFAETMFVDSPS--WKSVGRR
C0LGH2_______________NNIYIATSQSQFVNTLDSELFQSARLSASSVRYYGLGLENGGYTVTLQFAEIQILGSTSTTWKGLGRR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain