UniGene Name: sp_v3.0_unigene64298
Length: 210 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene64298
G |
Ace file of the UniGene sp_v3.0_unigene64298 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Putative gag-pol polyprotein, identical n=1 Tax=Solanum demissum RepID=Q6L3N8_SOLDE | - | - | 2.0e-17 | 58% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 64% |
Sma3 | Retrotransposon protein, putative, Ty1-copia subclass | - | - | 2.68e-12 | - |
Source | Gene names |
---|---|
Sma3 | F11I4_21; H0306F03.15; H0413E07.4; LOC_Os03g26290; LOC_Os10g01750; LOC_Os10g21080; LOC_Os10g34120; LOC_Os11g03830; LOC_Os11g05840; LOC_Os11g17390; LOC_Os11g28550; LOC_Os12g05520; LOC_Os12g31920; LOC_Os12g34770; LOC_Os12g44200; OSIGBa0127D24.3; OSIGBa0134J |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | nucleotide binding | GO:0000166 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
Sma3 | exonuclease activity | GO:0004527 | Molecular Function | 0.0 | - |
Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | transposition | GO:0032196 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | F-box domain, cyclin-like | IPR001810 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Haem peroxidase, plant/fungal/bacterial | IPR002016 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | Putative 5-3 exonuclease | IPR004859 | - | 0.0 | - |
Sma3 | IPR010256 | - | 0.0 | - | |
Sma3 | IPR013084 | - | 0.0 | - | |
Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
Sma3 | ABC-2 type transporter | IPR013525 | - | 0.0 | - |
Sma3 | F-box associated interaction domain | IPR017451 | - | 0.0 | - |
Sma3 | Peptidase A2A, retrovirus RVP subgroup | IPR018061 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKX7
Fln msg: Distance to subject end: 154 aas, your sequence is shorter than subject: 70 - 407
Fln protein:
E
Protein Length:
71
Fln nts:
G
Fln Alignment:
G5KS2UX02GGQ6W___EFKSMVEKQTRNYIKILRSDQGGEFKSREFN*YCKSNGVLQQFTVPHTPQQNGVAERKNRTLVECAR
B8LKX7_______________EFKAFVEKQSGKSIKILRTDNGKEYVNKEFDHYCKYNGIKREHTVPYTPQQNGVAERKNRTLMEMAR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain