UniGene Name: sp_v3.0_unigene64293
Length: 212 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene64293
A |
Ace file of the UniGene sp_v3.0_unigene64293
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Chalcone synthase (Fragment) n=4 Tax=Pseudotsuga RepID=C6F7B7_PSEMZ | - | - | 2.0e-30 | 89% |
| FL-Next | tr=Chalcone synthase; Pseudotsuga menziesii (Douglas-fir) (Abies menziesii). | - | - | 0.0 | 92% |
| Sma3 | Chalcone synthase | - | - | 5.368e-39 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Naringenin-chalcone synthase. | EC:2.3.1.74 | - | 4.614e-30 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Flavonoid biosynthesis | 00941 | 4.614e-30 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 4.614e-30 | % | |
| Sma3 | Metabolic pathways | 01100 | 4.614e-30 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 4.614e-30 | % |
| Source | Gene names |
|---|---|
| Sma3 | CHS; CHS-1; CHS-1A; CHS-1B; CHS-2; CHS-E; CHS-FL1; CHS1; CHS11; CHS17; CHS2; CHS3; CHS4; CHS4-1; CHS4-2; CHS5; CHS6; CHS6-4; CHS7; CHS8; CHS9; CHSI; CHSII; CSF7; Chs; Chs2; CtCHS; FrCHS2; FrCHS3; FrCHS5; ICHS1; MdCHS; PKS2; PKS3; PSD1; PSR2; PhCHS-1; Pks2 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | GO:0008415 | Molecular Function | 0.0 | - | |
| Sma3 | naringenin-chalcone synthase activity | GO:0016210 | Molecular Function | 0.0 | - |
| Sma3 | pinosylvin synthase activity | GO:0050198 | Molecular Function | 0.0 | - |
| Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
| Sma3 | biosynthetic process | GO:0009058 | Biological Process | 0.0 | - |
| Sma3 | flavonoid biosynthetic process | GO:0009813 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Chalcone/stilbene synthase, N-terminal | IPR001099 | - | 0.0 | - |
| Sma3 | Polyketide synthase, type III | IPR011141 | - | 0.0 | - |
| Sma3 | Chalcone/stilbene synthase, C-terminal | IPR012328 | - | 0.0 | - |
| Sma3 | Thiolase-like, subgroup | IPR016038 | - | 0.0 | - |
| Sma3 | Chalcone/stilbene synthase, active site | IPR018088 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G13930.1 | CHS, TT4, ATCHS Chalcone and stilbene synthase family protein chr5:4488762-4490035 FORWARD LENGTH=395 | 1.0e-28 | 75% |
| RefSeq | Arabidopsis thaliana | NP_196897.1 | chalcone synthase [Arabidopsis thaliana] | 2.0e-28 | 75% |
| RefSeq | Populus trichocarpa | XP_002337752.1 | chalcone synthase [Populus trichocarpa] | 2.0e-31 | 76% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q2ENC1
Fln msg: Distance to subject end: 125 aas, your sequence is shorter than subject: 70 - 395
Fln protein:
M
Protein Length:
71
Fln nts:
A
Fln Alignment:
G5KS2UX02JK4HE___MSFRGPSDTHLDSMVGQALFGDGASALIVGADPIPEVEKPCFELLWTAQTILPDSGGAIDGHLREAGLT
Q2ENC1_______________VTFRGPSDTHLDSMVGQALFGDGASALIVGADPIPQVEKPCFELLWTAQTILPDSDGAIDGHLREVGLT

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta