UniGene Name: sp_v3.0_unigene64290
Length: 206 nt
UniGene Fasta |
---|
>sp_v3.0_unigene64290
A |
Ace file of the UniGene sp_v3.0_unigene64290 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Reverse transcriptase (Fragment) n=1 Tax=Taxus baccata RepID=Q56GF5_TAXBA | - | - | 2.0e-10 | 57% |
FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 65% |
Sma3 | Reverse transcriptase | - | - | 5.134e-16 | - |
Source | Gene names |
---|---|
Sma3 | H0124B04.16; LOC_Os03g05340; LOC_Os03g05350; LOC_Os03g30710; LOC_Os03g31930; LOC_Os03g61190; LOC_Os10g06270; LOC_Os10g08820; LOC_Os10g10460; LOC_Os10g12630; LOC_Os10g16720; LOC_Os10g16880; LOC_Os10g16900; LOC_Os10g17050; LOC_Os10g17560; LOC_Os10g17820; LO |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: A5B2I6
Fln msg: Overlapping hits, possible frame ERROR between 160 and 157, Distance to subject end: 870 aas, your sequence is shorter than subject: 68 - 2232
Fln protein:
M
Protein Length:
69
Fln nts:
A
Fln Alignment:
G5KS2UX02I1NQB___YR*LNXXXXXXXXXXXXXNEMLDELHGAKYFSKLDLRSGYYQIRIRLEDIPxTTFRTHEGHYEFKVI
A5B2I6_______________YRALNKVTVPDRFPIPVIDELLDKLHGATIFSKLDLKSGYHQIRVRQQDIPxTAFRTHEGHYEFLVM
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain