UniGene Name: sp_v3.0_unigene64234
Length: 150 nt
![]() |
---|
>sp_v3.0_unigene64234
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Pentatricopeptide repeat protein (Fragment) n=1 Tax=Metzgeria furcata RepID=B3U1P8_9MARC | - | - | 2.0e-11 | 72% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 84% |
Sma3 | Pentatricopeptide repeat protein | - | - | 0.0 | - |
Source | Gene names |
---|---|
Sma3 | At1g59720; At2g22070; At3g03580; At3g57430; At4g33170; At4g33990; At4g37380; B1080A02.28; EMB2758; F17I5.180; F23H11.3; F4I10.100; F6G17.30; GSVIVT00002188001; GSVIVT00003060001; GSVIVT00006467001; GSVIVT00006516001; GSVIVT00007631001; GSVIVT00007922001; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | mRNA modification | GO:0016556 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Beta-lactamase, class-A/D | IPR000871 | - | 0.0 | - |
Sma3 | Mannose-binding lectin | IPR001229 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | MAP kinase, conserved site | IPR003527 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G33170.1 | Tetratricopeptide repeat (TPR)-like superfamily protein chr4:15995701-15998673 REVERSE LENGTH=990 | 9.0e-14 | 70% |
RefSeq | Arabidopsis thaliana | NP_195043.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 1.0e-13 | 70% |
RefSeq | Populus trichocarpa | XP_002303271.1 | predicted protein [Populus trichocarpa] | 4.0e-13 | 67% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AAE0
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 25 aas, your sequence is shorter than subject: 49 - 246
Fln protein:
E
Protein Length:
50
Fln nts:
G
Fln Alignment:
G5KS2UX02FLTS6___AIAFGLISTPPTVPIRIMKNLRVCGDCHMATKFISKIV
D5AAE0_______________AIAFGLISTLPGLPVRIIKNLRVCGDCHTATKFISKIV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain