UniGene Name: sp_v3.0_unigene64204
Length: 218 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene64204
C |
Ace file of the UniGene sp_v3.0_unigene64204 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Protein translocase subunit secA n=1 Tax=Populus trichocarpa RepID=B9I9A8_POPTR | - | - | 4.0e-31 | 88% |
FL-Next | sp=Protein translocase subunit SECA1, chloroplastic; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 85% |
Sma3 | Protein translocase subunit secA | - | - | 0.0 | - |
Source | Gene names |
---|---|
Sma3 | At4g01800; CHLREDRAFT_121029; CHLREDRAFT_131439; CHLREDRAFT_138696; F8K7.6; GSVIVT00015443001; GSVIVT00028237001; Grc000191; Heak293_Cp114; LOC_Os11g08980; MICPUCDRAFT_34584; MICPUCDRAFT_45843; MICPUN_101824; MICPUN_103130; OSTLU_36933; OSTLU_49779; Os01g |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | protein disulfide oxidoreductase activity | GO:0015035 | Molecular Function | 0.0 | - |
Sma3 | protein targeting | GO:0006605 | Biological Process | 0.0 | - |
Sma3 | protein import | GO:0017038 | Biological Process | 0.0 | - |
Sma3 | cell redox homeostasis | GO:0045454 | Biological Process | 0.0 | - |
Sma3 | intracellular protein transmembrane transport | GO:0065002 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | SecA protein | IPR000185 | - | 0.0 | - |
Sma3 | WD40 repeat | IPR001680 | - | 0.0 | - |
Sma3 | Zinc finger, RING-type | IPR001841 | - | 0.0 | - |
Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
Sma3 | Glutaredoxin | IPR002109 | - | 0.0 | - |
Sma3 | SecA DEAD-like, N-terminal | IPR011115 | - | 0.0 | - |
Sma3 | SecA Wing/Scaffold | IPR011116 | - | 0.0 | - |
Sma3 | SecA preprotein, cross-linking domain | IPR011130 | - | 0.0 | - |
Sma3 | SecA motor DEAD | IPR014018 | - | 0.0 | - |
Sma3 | WD40/YVTN repeat-like-containing domain | IPR015943 | - | 0.0 | - |
Sma3 | WD40-repeat-containing domain | IPR017986 | - | 0.0 | - |
Sma3 | Zinc finger, C3HC4 RING-type | IPR018957 | - | 0.0 | - |
Sma3 | IPR019782 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G21650.3 | SECA2 Preprotein translocase SecA family protein chr1:7592891-7604152 REVERSE LENGTH=1805 | 7.0e-32 | 76% |
RefSeq | Arabidopsis thaliana | NP_192089.1 | preprotein translocase subunit secA [Arabidopsis thaliana] | 5.0e-37 | 85% |
RefSeq | Populus trichocarpa | XP_002320935.1 | predicted protein [Populus trichocarpa] | 2.0e-38 | 88% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9SYI0
Fln msg: Distance to subject end: 759 aas, your sequence is shorter than subject: 72 - 1022
Fln protein:
L
Protein Length:
73
Fln nts:
C
Fln Alignment:
G5KS2UX02FLB45___LNALTGKGVHLVTVNDYLARRDCEWVGQVPRFLGLNVGLIQQNMSSEERRANYSCDMTYVTNSELGFDYLR
Q9SYI0_______________LNALSGKGVHVVTVNDYLARRDCEWVGQVPRFLGLKVGLIQQNMTPEQRKENYLCDITYVTNSELGFDYLR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain