SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene64175

Length: 163 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene64175
GATGTGGAGAAGGCTGCAGATCTAACCTATTGGGAAAGCGCAGCTCGAATGATTGCGGACGTTTCAAAATCTGACAAAATTGTTGTGGAGAAATCTACAGTTCCAGTAAAAACAGCAGAGGCAATTGAGAAAAAATTAACTCACACATAATACCAAGGGAATT

Ace file of the UniGene sp_v3.0_unigene64175 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	UDP-glucose dehydrogenase [Cinnamomum osmophloeum]	-	-	5.0e-16	97%
FL-Next	sp=UDP-glucose 6-dehydrogenase; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	97%
Sma3	UDP-glucose dehydrogenase	-	-	3.882e-32	-

Source	ECs	Term	Type	e value	Identity
Sma3	UDP-glucose 6-dehydrogenase.	EC:1.1.1.22	-	3.579e-28	-

Source	KEGGs	Term	e value	Identity
Sma3	Pentose and glucuronate interconversions	00040	3.579e-28	%
Sma3	Ascorbate and aldarate metabolism	00053	3.579e-28	%
Sma3	Starch and sucrose metabolism	00500	3.579e-28	%
Sma3	Amino sugar and nucleotide sugar metabolism	00520	3.579e-28	%
Sma3	Metabolic pathways	01100	3.579e-28	%
Sma3	Biosynthesis of secondary metabolites	01110	3.579e-28	%

Source	Gene names
Sma3	170F8.20; At1g26570; At3g29360; At5g15490; At5g39320; CHLREDRAFT_185081; CHLREDRAFT_205498; EZY12; GSVIVT00016253001; GSVIVT00021053001; GSVIVT00030060001; K3K3.170; LOC_Os03g05360; LOC_Os03g31210; LOC_Os03g40720; LOC_Os03g55070; LOC_Os12g25690; LOC_Os12g

Source	GOs	Term	Type	Identity
Sma3	cell wall	GO:0005618	Cellular Component	-
Sma3	nucleic acid binding	GO:0003676	Molecular Function	-
Sma3	UDP-glucose 6-dehydrogenase activity	GO:0003979	Molecular Function	-
Sma3	aspartic-type endopeptidase activity	GO:0004190	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	GO:0016616	Molecular Function	-
Sma3	NAD binding	GO:0051287	Molecular Function	-
Sma3	proteolysis	GO:0006508	Biological Process	-
Sma3	metabolic process	GO:0008152	Biological Process	-
Sma3	oxidation-reduction process	GO:0055114	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	UDP-glucose/GDP-mannose dehydrogenase, N-terminal	IPR001732	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Peptidase aspartic, active site	IPR001969	-	-
Sma3	Transposase, MuDR, plant	IPR004332	-	-
Sma3	Retrotransposon gag protein	IPR005162	-	-
Sma3	Zinc finger, PMZ-type	IPR006564	-	-
Sma3	Zinc finger, SWIM-type	IPR007527	-	-
Sma3	Dehydrogenase, multihelical	IPR013328	-	-
Sma3	UDP-glucose/GDP-mannose dehydrogenase, dimerisation	IPR014026	-	-
Sma3	UDP-glucose/GDP-mannose dehydrogenase, C-terminal	IPR014027	-	-
Sma3		IPR014028	-	-
Sma3	NAD(P)-binding domain	IPR016040	-	-
Sma3	Nucleotide sugar dehydrogenase	IPR017476	-	-
Sma3	MULE transposase domain	IPR018289	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT5G15490.1	UDP-glucose 6-dehydrogenase family protein chr5:5027872-5029314 REVERSE LENGTH=480	2.0e-20	95%
RefSeq	Arabidopsis thaliana	NP_197053.1	UDPglucose 6-dehydrogenase [Arabidopsis thaliana]	2.0e-20	95%
RefSeq	Populus trichocarpa	XP_002316095.1	predicted protein [Populus trichocarpa]	2.0e-21	97%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LPB2

Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 333 aas, your sequence is shorter than subject: 50 - 482

Fln protein: DVEKAADLTYWESAARMIADVSKSDKIVVEKSTVPVKTAEAIEKKLTHT*

Protein Length: 51

Fln nts: GATGTGGAGAAGGCTGCAGATCTAACCTATTGGGAAAGCGCAGCTCGAATGATTGCGGACGTTTCAAAATCTGACAAAATTGTTGTGGAGAAATCTACAGTTCCAGTAAAAACAGCAGAGGCAATTGAGAAAAAATTAACTCACACATAATACCAAGGGAATT

Fln Alignment:

G5KS2UX02HSN62___KAADLTYWESAARMIADVSKSDKIVVEKSTVPVKTAEAIEKKLTH
B8LPB2_______________KAADLTYWESAARMIADVSKSDKIVVEKSTVPVKTAEAIEKILTH

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain