UniGene Name: sp_v3.0_unigene64175
Length: 163 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene64175
G |
Ace file of the UniGene sp_v3.0_unigene64175 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | UDP-glucose dehydrogenase [Cinnamomum osmophloeum] | - | - | 5.0e-16 | 97% |
| FL-Next | sp=UDP-glucose 6-dehydrogenase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 97% |
| Sma3 | UDP-glucose dehydrogenase | - | - | 3.882e-32 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | UDP-glucose 6-dehydrogenase. | EC:1.1.1.22 | - | 3.579e-28 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pentose and glucuronate interconversions | 00040 | 3.579e-28 | % | |
| Sma3 | Ascorbate and aldarate metabolism | 00053 | 3.579e-28 | % | |
| Sma3 | Starch and sucrose metabolism | 00500 | 3.579e-28 | % | |
| Sma3 | Amino sugar and nucleotide sugar metabolism | 00520 | 3.579e-28 | % | |
| Sma3 | Metabolic pathways | 01100 | 3.579e-28 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 3.579e-28 | % |
| Source | Gene names |
|---|---|
| Sma3 | 170F8.20; At1g26570; At3g29360; At5g15490; At5g39320; CHLREDRAFT_185081; CHLREDRAFT_205498; EZY12; GSVIVT00016253001; GSVIVT00021053001; GSVIVT00030060001; K3K3.170; LOC_Os03g05360; LOC_Os03g31210; LOC_Os03g40720; LOC_Os03g55070; LOC_Os12g25690; LOC_Os12g |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | UDP-glucose 6-dehydrogenase activity | GO:0003979 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor | GO:0016616 | Molecular Function | 0.0 | - |
| Sma3 | NAD binding | GO:0051287 | Molecular Function | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | UDP-glucose/GDP-mannose dehydrogenase, N-terminal | IPR001732 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
| Sma3 | Transposase, MuDR, plant | IPR004332 | - | 0.0 | - |
| Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
| Sma3 | Zinc finger, PMZ-type | IPR006564 | - | 0.0 | - |
| Sma3 | Zinc finger, SWIM-type | IPR007527 | - | 0.0 | - |
| Sma3 | Dehydrogenase, multihelical | IPR013328 | - | 0.0 | - |
| Sma3 | UDP-glucose/GDP-mannose dehydrogenase, dimerisation | IPR014026 | - | 0.0 | - |
| Sma3 | UDP-glucose/GDP-mannose dehydrogenase, C-terminal | IPR014027 | - | 0.0 | - |
| Sma3 | IPR014028 | - | 0.0 | - | |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Sma3 | Nucleotide sugar dehydrogenase | IPR017476 | - | 0.0 | - |
| Sma3 | MULE transposase domain | IPR018289 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G15490.1 | UDP-glucose 6-dehydrogenase family protein chr5:5027872-5029314 REVERSE LENGTH=480 | 2.0e-20 | 95% |
| RefSeq | Arabidopsis thaliana | NP_197053.1 | UDPglucose 6-dehydrogenase [Arabidopsis thaliana] | 2.0e-20 | 95% |
| RefSeq | Populus trichocarpa | XP_002316095.1 | predicted protein [Populus trichocarpa] | 2.0e-21 | 97% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LPB2
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 333 aas, your sequence is shorter than subject: 50 - 482
Fln protein:
D
Protein Length:
51
Fln nts:
G
Fln Alignment:
G5KS2UX02HSN62___KAADLTYWESAARMIADVSKSDKIVVEKSTVPVKTAEAIEKKLTH
B8LPB2_______________KAADLTYWESAARMIADVSKSDKIVVEKSTVPVKTAEAIEKILTH

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)