UniGene Name: sp_v3.0_unigene64121
Length: 234 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene64121
T |
Ace file of the UniGene sp_v3.0_unigene64121 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Serine/threonine-protein kinase PBS1, putative n=1 Tax=Ricinus communis RepID=B9RNY7_RICCO | - | - | 6.0e-19 | 59% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 53% |
| Sma3 | Chromosome chr19 scaffold_4, whole genome shotgun sequence | - | - | 7.071e-13 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 4.487e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT1G53420; AT1G71830; AT2G13790; AT3G14840; At2g13780; At2g13790; At2g48010; At4g33430; BAK1; ERL1a; F14O23.21; F17M5.190; GSVIVT00001301001; GSVIVT00001777001; GSVIVT00005156001; GSVIVT00005183001; GSVIVT00009439001; GSVIVT00009544001; GSVIVT00010206001; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | endosome membrane | GO:0010008 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | protein complex | GO:0043234 | Cellular Component | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | response to chitin | GO:0010200 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G53420.1 | Leucine-rich repeat transmembrane protein kinase chr1:19926626-19931494 REVERSE LENGTH=953 | 4.0e-23 | 58% |
| RefSeq | Arabidopsis thaliana | NP_175747.2 | putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis thaliana] | 6.0e-23 | 58% |
| RefSeq | Populus trichocarpa | XP_002324316.1 | predicted protein, partial [Populus trichocarpa] | 8.0e-24 | 56% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NQB9
Fln msg: Distance to subject end: 180 aas, your sequence is shorter than subject: 77 - 290
Fln protein:
D
Protein Length:
78
Fln nts:
T
Fln Alignment:
G5KS2UX02F1O9W___DFMENGSLADCLFNPNRSTSLSWPERYKISVGIARGLTYLHEFAKPSIIHRDVKAANVLLDAQLNALVADFGLAKL
A9NQB9_______________EYLPNKSLDKLLFNPERRKVLDWQKRYNIIIGVARGLLYLHQDSQLRIIHRDVKVNNILLDDKLNPKIADFGLARL

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)