UniGene Name: sp_v3.0_unigene64107
Length: 209 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene64107
A |
Ace file of the UniGene sp_v3.0_unigene64107
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Os02g0494700 protein n=2 Tax=Oryza sativa RepID=Q0E138_ORYSJ | - | - | 5.0e-21 | 82% |
| FL-Next | sp=Transcriptional activator DEMETER; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 83% |
| Sma3 | Repressor of silencing 1 | - | - | 2.159e-08 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Hydrolases, Glycosylases, Hydrolyzing N-glycosyl compounds. | EC:3.2.2.- | - | 1.405e-12 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g36490; At3g10010; At4g34060; At5g04560/At5g04570/At5g04580; DME; DML1; DML2; DML3; DNG701; DNG902; DNG904; ETFPPS1; F1O11.12; F28A23.180; GSVIVT00021675001; GSVIVT00022090001; GSVIVT00034990001; NtROS1; NtROS2a; NtROS2b; NtROS3; OJ1288_D09.7; Os01g021 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | DNA-(apurinic or apyrimidinic site) lyase activity | GO:0003906 | Molecular Function | 0.0 | - |
| Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | DNA N-glycosylase activity | GO:0019104 | Molecular Function | 0.0 | - |
| Sma3 | 4 iron, 4 sulfur cluster binding | GO:0051539 | Molecular Function | 0.0 | - |
| Sma3 | DNA repair | GO:0006281 | Biological Process | 0.0 | - |
| Sma3 | base-excision repair | GO:0006284 | Biological Process | 0.0 | - |
| Sma3 | DNA methylation | GO:0006306 | Biological Process | 0.0 | - |
| Sma3 | regulation of gene expression by genetic imprinting | GO:0006349 | Biological Process | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Sma3 | maintenance of DNA methylation | GO:0010216 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of chromatin silencing | GO:0031936 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Regulator of chromosome condensation, RCC1 | IPR000408 | - | 0.0 | - |
| Sma3 | HhH-GPD domain | IPR003265 | - | 0.0 | - |
| Sma3 | Endonuclease III-like, iron-sulphur cluster loop motif | IPR003651 | - | 0.0 | - |
| Sma3 | Endonuclease III, iron-sulphur binding site | IPR004035 | - | 0.0 | - |
| Sma3 | AT hook, DNA-binding motif | IPR017956 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G04560.2 | DME HhH-GPD base excision DNA repair family protein chr5:1309786-1318091 FORWARD LENGTH=1987 | 5.0e-23 | 83% |
| RefSeq | Arabidopsis thaliana | NP_001078527.1 | transcriptional activator DEMETER [Arabidopsis thaliana] | 7.0e-23 | 83% |
| RefSeq | Populus trichocarpa | XP_002326243.1 | predicted protein [Populus trichocarpa] | 8.0e-24 | 87% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q8LK56
Fln msg: Separated hits, possible frame ERROR between 154 and 156, Distance to subject end: 393 aas, your sequence is shorter than subject: 70 - 1987
Fln protein:
M
Protein Length:
71
Fln nts:
A
Fln Alignment:
G5KS2UX02F6CCW___PDDAKNFLLSIRGLGLKSVECIRLLTLQQLAFPVDTNVGRICVRLGWVPxIEPLPESVQIHLLEQYPV
Q8LK56_______________PDKAKDYLLSIRGLGLKSVECVRLLTLHNLAFPVDTNVGRIAVRMGWVPxLQPLPESLQLHLLELYPV

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta