UniGene Name: sp_v3.0_unigene64106
Length: 234 nt
UniGene Fasta |
---|
>sp_v3.0_unigene64106
G |
Ace file of the UniGene sp_v3.0_unigene64106 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Lipoxygenase n=1 Tax=Picea sitchensis RepID=B8LLK5_PICSI | - | - | 5.0e-29 | 83% |
FL-Next | sp=Lipoxygenase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 83% |
Sma3 | Lipoxygenase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Lipoxygenase. | EC:1.13.11.12 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Linoleic acid metabolism | 00591 | 0.0 | % | |
Sma3 | alpha-Linolenic acid metabolism | 00592 | 0.0 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | ACRE44; At1g17420; At1g67560; At1g72520; At3g45140; AtLOX6; B1168A08.24; B1168A08.28-1; B1168A08.28-2; CM-LOX1; CM-LOX2; F12B7.11; F28G4.10; F28P22.29; GSVIVT00004618001; GSVIVT00008869001; GSVIVT00013069001; GSVIVT00019960001; GSVIVT00022800001; GSVIVT00 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | lipoxygenase activity | GO:0016165 | Molecular Function | 0.0 | - |
Sma3 | phytoene dehydrogenase activity | GO:0016166 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen | GO:0016702 | Molecular Function | 0.0 | - |
Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
Sma3 | response to fungus | GO:0009620 | Biological Process | 0.0 | - |
Sma3 | jasmonic acid biosynthetic process | GO:0009695 | Biological Process | 0.0 | - |
Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
Sma3 | oxylipin biosynthetic process | GO:0031408 | Biological Process | 0.0 | - |
Sma3 | root development | GO:0048364 | Biological Process | 0.0 | - |
Sma3 | response to other organism | GO:0051707 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ketose-bisphosphate aldolase, class-II | IPR000771 | - | 0.0 | - |
Sma3 | Peptidase M14, carboxypeptidase A | IPR000834 | - | 0.0 | - |
Sma3 | Lipoxygenase | IPR000907 | - | 0.0 | - |
Sma3 | Lipoxygenase, LH2 | IPR001024 | - | 0.0 | - |
Sma3 | WW/Rsp5/WWP | IPR001202 | - | 0.0 | - |
Sma3 | Lipoxygenase, plant | IPR001246 | - | 0.0 | - |
Sma3 | Lipoxygenase, C-terminal | IPR013819 | - | 0.0 | - |
Sma3 | Hemopexin/matrixin, conserved site | IPR018486 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G67560.1 | LOX6 PLAT/LH2 domain-containing lipoxygenase family protein chr1:25319926-25324117 FORWARD LENGTH=917 | 2.0e-27 | 69% |
RefSeq | Arabidopsis thaliana | NP_176923.1 | lipoxygenase 6 [Arabidopsis thaliana] | 2.0e-27 | 69% |
RefSeq | Populus trichocarpa | XP_002314548.1 | predicted protein [Populus trichocarpa] | 5.0e-28 | 69% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLK5
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 291 aas, your sequence is shorter than subject: 77 - 930
Fln protein:
S
Protein Length:
78
Fln nts:
G
Fln Alignment:
G5KS2UX02FUDMN___KAHARANDAGYHQLISHWLRTHAAMELFIIATHRQLSRMHPMYKLLIPHYLDTMDINQAARKSLINAAGIIE
B8LLK5_______________RAHARVNDSGYHQLISHWLTTHAIMEPFIIATHRQLSKMHPLYKLLIPHYLNTMDINQAARQSLINADGVIE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain