UniGene Name: sp_v3.0_unigene64075
Length: 233 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene64075
A |
Ace file of the UniGene sp_v3.0_unigene64075
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Kinase, putative n=1 Tax=Ricinus communis RepID=B9SDY6_RICCO | - | - | 7.0e-18 | 63% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 61% |
| Sma3 | Putative receptor-type protein kinase LRK1 | - | - | 1.423e-14 | - |
| Source | Gene names |
|---|---|
| Sma3 | At3g59700; GSVIVT00015995001; GSVIVT00018441001; GSVIVT00021359001; GSVIVT00021360001; GSVIVT00031525001; LECRK1; LecRK7; OJ1562_B11.129; OJ1562_B11.130; OJ1562_B11.131; OJ1606_D04.102; OJ1606_D04.117; OJ1606_D04.122; OSIGBa0125M19.6; OSIGBa0125M19.7; OSJ |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | cell surface | GO:0009986 | Cellular Component | 0.0 | - |
| Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
| Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
| Sma3 | IPR001899 | - | 0.0 | - | |
| Sma3 | Short-chain dehydrogenase/reductase SDR | IPR002198 | - | 0.0 | - |
| Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
| Sma3 | Glucose/ribitol dehydrogenase | IPR002347 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Concanavalin A-like lectin/glucanase, subgroup | IPR013320 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G59700.1 | ATHLECRK, LECRK1, HLECRK lectin-receptor kinase chr3:22052146-22054131 FORWARD LENGTH=661 | 1.0e-19 | 56% |
| RefSeq | Arabidopsis thaliana | NP_191529.1 | lectin-receptor kinase [Arabidopsis thaliana] | 1.0e-19 | 56% |
| RefSeq | Populus trichocarpa | XP_002323515.1 | predicted protein [Populus trichocarpa] | 3.0e-20 | 49% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NVC0
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 263 aas, your sequence is shorter than subject: 77 - 636
Fln protein:
C
Protein Length:
78
Fln nts:
A
Fln Alignment:
G5KS2UX02HY7VZ___VLASLAAVYVIRVIRQSEVIEEWELEYGPHRFPYSELKVATKGFRDKQLLGFGGFGRVYKGVI
A9NVC0_______________LLAIAAAVFLKRVIKR-ETIEEWEEEYWPHRFTYKELSIATSRFRDENVLGYGGFGMVYKGVL

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta