SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene63990

Length: 180 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene63990
GGATATATTCCAGACACCAGCCTTGTGTTACATGAACTAACAGAGGGTAAGAAAGAACAACGTATCCGTCACCATAGTGAGAGGCTGGCCATTGCTTTTGGGCTTATCACTATGCCTCCTGGGATACCTATAAGGATAATTAAGAACCTTCGAGTGTGTGGTGACTGCCACACTGACATT

Ace file of the UniGene sp_v3.0_unigene63990 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Pentatricopeptide repeat protein (Fragment) n=1 Tax=Lepidogyna hodgsoniae RepID=B3U1Z4_9MARC	-	-	6.0e-19	72%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	67%
Sma3	Pentatricopeptide repeat protein	-	-	0.0	-

Source	Gene names
Sma3	At1g25360; At1g47580; At1g56690; At2g02980; At2g15690; At2g22070; At2g27610; At2g41080; At3g61170; At4g14050; At4g30700; At4g37380; At5g52630; DYW9; F10A12.28; F15K20.29; F16N3.14; F25P12.87; F4F7.25; F6G17.30; F6N7.12; F9O13.24; FCAALL.80; GSVIVT00002188

Source	GOs	Term	Type	Identity
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	ribosome	GO:0005840	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	RNA binding	GO:0003723	Molecular Function	-
Sma3	structural constituent of ribosome	GO:0003735	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	binding	GO:0005488	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	DNA methylation	GO:0006306	Biological Process	-
Sma3	translation	GO:0006412	Biological Process	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	thiamine biosynthetic process	GO:0009228	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Ribosomal protein S3, C-terminal	IPR001351	-	-
Sma3	C-5 cytosine methyltransferase	IPR001525	-	-
Sma3	Thiamine biosynthesis protein ThiC	IPR002817	-	-
Sma3	Pentatricopeptide repeat	IPR002885	-	-
Sma3	Immunoglobulin/major histocompatibility complex, conserved site	IPR003006	-	-
Sma3	MAP kinase, conserved site	IPR003527	-	-
Sma3	Domain of unknown function DUF221	IPR003864	-	-
Sma3	K Homology domain, type 2	IPR004044	-	-
Sma3	K Homology domain	IPR004087	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Tetratricopeptide-like helical	IPR011990	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	Asp/Glu racemase, active site	IPR018187	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G47580.1	Pentatricopeptide repeat (PPR) superfamily protein chr1:17485668-17486387 FORWARD LENGTH=239	8.0e-23	61%
RefSeq	Arabidopsis thaliana	NP_175189.2	putative lipoyltransferase [Arabidopsis thaliana]	1.0e-22	61%
RefSeq	Populus trichocarpa	XP_002303271.1	predicted protein [Populus trichocarpa]	8.0e-22	63%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: D5AAE0

Fln msg: Distance to subject end: 33 aas, your sequence is shorter than subject: 60 - 246

Fln protein: GYIPDTSLVLHELTEGKKEQRIRHHSERLAIAFGLITMPPGIPIRIIKNLRVCGDCHTDI

Protein Length: 61

Fln nts: GGATATATTCCAGACACCAGCCTTGTGTTACATGAACTAACAGAGGGTAAGAAAGAACAACGTATCCGTCACCATAGTGAGAGGCTGGCCATTGCTTTTGGGCTTATCACTATGCCTCCTGGGATACCTATAAGGATAATTAAGAACCTTCGAGTGTGTGGTGACTGCCACACTGACATT

Fln Alignment:

G5KS2UX02I31CJ___GYIPDTSLVLHELTEGKKEQRIRHHSERLAIAFGLITMPPGIPIRIIKNLRVCGDCHT
D5AAE0_______________GYVPDTNFVLHDVEMEQKEHSLYHHSEKLAIAFGLISTLPGLPVRIIKNLRVCGDCHT

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain