UniGene Name: sp_v3.0_unigene63970
Length: 229 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene63970
G |
Ace file of the UniGene sp_v3.0_unigene63970 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | DNA topoisomerase n=1 Tax=Physcomitrella patens subsp. patens RepID=A9U3N3_PHYPA | - | - | 3.0e-25 | 80% |
FL-Next | sp=DNA topoisomerase; Physcomitrella patens subsp. patens (Moss). | - | - | 0.0 | 80% |
Sma3 | Putative DNA topoisomerase III beta | - | - | 1.635e-08 | - |
Source | Gene names |
---|---|
Sma3 | At2g32000; CHLREDRAFT_138607; GSVIVT00002401001; GSVIVT00033522001; MICPUN_79081; Os09g0500600; OsI_31918; PHYPADRAFT_228008; POPTRDRAFT_1099630; RCOM_1646110; VITISV_028119; VITISV_040319; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromosome | GO:0005694 | Cellular Component | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | DNA topoisomerase type I activity | GO:0003917 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | cysteine-type endopeptidase activity | GO:0004197 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | DNA topological change | GO:0006265 | Biological Process | 0.0 | - |
Sma3 | DNA unwinding involved in replication | GO:0006268 | Biological Process | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | DNA topoisomerase, type IA | IPR000380 | - | 0.0 | - |
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Peptidase C13, legumain | IPR001096 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
Sma3 | DNA topoisomerase, type IA, domain 2 | IPR003601 | - | 0.0 | - |
Sma3 | DNA topoisomerase, type IA, DNA-binding | IPR003602 | - | 0.0 | - |
Sma3 | IPR006154 | - | 0.0 | - | |
Sma3 | Toprim domain | IPR006171 | - | 0.0 | - |
Sma3 | Zinc finger, PMZ-type | IPR006564 | - | 0.0 | - |
Sma3 | Zinc finger, SWIM-type | IPR007527 | - | 0.0 | - |
Sma3 | DNA topoisomerase, type IA, central | IPR013497 | - | 0.0 | - |
Sma3 | DNA topoisomerase, type IA, central region, subdomain 1 | IPR013824 | - | 0.0 | - |
Sma3 | DNA topoisomerase, type IA, central region, subdomain 3 | IPR013826 | - | 0.0 | - |
Sma3 | MULE transposase domain | IPR018289 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G32000.1 | DNA topoisomerase, type IA, core chr2:13615999-13621563 REVERSE LENGTH=865 | 2.0e-24 | 62% |
RefSeq | Arabidopsis thaliana | NP_001031463.1 | DNA topoisomerase III [Arabidopsis thaliana] | 3.0e-24 | 62% |
RefSeq | Populus trichocarpa | XP_002321105.1 | predicted protein [Populus trichocarpa] | 1.0e-23 | 59% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: A9U3N3
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 712 aas, your sequence is shorter than subject: 71 - 869
Fln protein:
A
Protein Length:
72
Fln nts:
G
Fln Alignment:
G5KS2UX02H99LM___APIIKVESNPKARICKHLQHEAHGCDYLVLWLDCDREGENICFEVMGCTVNVLRKGNGQQVFRARFSAIN
A9U3N3_______________APTIKNESNPKAHVCKHLQQEARGCDYLVLWLDCDREGENICFEVMESAVPVLRKLPGQQVFRAKFSAIS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain