UniGene Name: sp_v3.0_unigene63956
Length: 241 nt
UniGene Fasta |
---|
>sp_v3.0_unigene63956
A |
Ace file of the UniGene sp_v3.0_unigene63956 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | ATP-binding cassette transporter, putative n=1 Tax=Ricinus communis RepID=B9S9X8_RICCO | - | - | 2.0e-23 | 69% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 62% |
Sma3 | White-brown-complex ABC transporter family | - | - | 1.637e-24 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Molybdate-transporting ATPase. | EC:3.6.3.29 | - | 1.236e-07 | - |
Source | Gene names |
---|---|
Sma3 | At1g31770; At3g13220; At3g52310; At4g27420; At5g06530; F27G19.20; F27M3.2; F5M6.22; GSVIVT00001167001; GSVIVT00002251001; GSVIVT00027138001; GSVIVT00027624001; GSVIVT00030260001; GSVIVT00031837001; GSVIVT00033423001; LOC_Os03g06139; MJG19.19; OJ1449_C01.5 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | intrinsic to membrane | GO:0031224 | Cellular Component | 0.0 | - |
Sma3 | transmembrane signaling receptor activity | GO:0004888 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
Sma3 | innate immune response | GO:0045087 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Toll/interleukin-1 receptor homology (TIR) domain | IPR000157 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | NB-ARC | IPR002182 | - | 0.0 | - |
Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
Sma3 | Leucine-rich repeat, typical subtype | IPR003591 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
Sma3 | Leucine-rich repeat 3 | IPR011713 | - | 0.0 | - |
Sma3 | ABC-2 type transporter | IPR013525 | - | 0.0 | - |
Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G13220.1 | WBC27, ABCG26 ABC-2 type transporter family protein chr3:4247968-4250703 REVERSE LENGTH=685 | 7.0e-27 | 65% |
RefSeq | Arabidopsis thaliana | NP_187928.2 | ABC-2 type transporter family protein [Arabidopsis thaliana] | 9.0e-27 | 65% |
RefSeq | Populus trichocarpa | XP_002328852.1 | white-brown-complex ABC transporter family, partial [Populus trichocarpa] | 5.0e-28 | 65% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LNF9
Fln msg: Distance to subject end: 512 aas, your sequence is shorter than subject: 79 - 819
Fln protein:
C
Protein Length:
80
Fln nts:
A
Fln Alignment:
G5KS2UX02F51PG___KKILNGITGYVASKQILALMGPSGSGKTTLLKIIGGRIQGKLTGSLTYNGVPYSNALKRRIGFVTQEDILYDKLTVYE
B8LNF9_______________KDILYGVSGSIAPGEMLAMMGPSGSGKTTLINLLGGRIQQNVSGSITYNDQPYSKALKRRIGFVTQDDVLFPHLTVRE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain