UniGene Name: sp_v3.0_unigene63953
Length: 193 nt
UniGene Fasta |
---|
>sp_v3.0_unigene63953
A |
Ace file of the UniGene sp_v3.0_unigene63953 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q9LND4.1|PPR14_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g06140, mitochondrial; Flags: Precursor gb|AAF80137.1|AC024174_19 Contains similarity to a hypothetical | - | - | 3.0e-15 | 63% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 70% |
Sma3 | Putative pentatricopeptide (PPR) repeat-containing protein | - | - | 1.028e-09 | - |
Source | Gene names |
---|---|
Sma3 | At1g06140; At1g20230; At1g74630; At2g03880; At2g13600; At3g49170; At4g01030; At4g02750; At4g30700; At5g15340; At5g40410; B1130E07.12; DYW9; EMB2261; F1M20.31; F2K15.30; F3I3.50; F8M21_230; GSVIVT00000138001; GSVIVT00004068001; GSVIVT00006499001; GSVIVT000 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Inositol polyphosphate-related phosphatase | IPR000300 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
Sma3 | Adenosine/AMP deaminase domain | IPR001365 | - | 0.0 | - |
Sma3 | Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1 | IPR001578 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Endonuclease/exonuclease/phosphatase | IPR005135 | - | 0.0 | - |
Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G06140.1 | Pentatricopeptide repeat (PPR) superfamily protein chr1:1864796-1866472 FORWARD LENGTH=558 | 3.0e-20 | 63% |
RefSeq | Arabidopsis thaliana | NP_172104.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 4.0e-20 | 63% |
RefSeq | Populus trichocarpa | XP_002302824.1 | predicted protein [Populus trichocarpa] | 2.0e-20 | 65% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ADG9
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 214 aas, your sequence is shorter than subject: 61 - 312
Fln protein:
C
Protein Length:
62
Fln nts:
A
Fln Alignment:
G5KS2UX02G8RGZ___VTPDGITLTSVLSACSHAGLVNEGWQYFRSMSHDYGIMPTVEHYACMVDLLGRSG
D5ADG9_______________VKPNEITFISVLSACSHAGLVDEGWKCYNCMTLDYAITPTVEHYACMVDLLGRAG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain