|
||||||
|
UniGene Name: sp_v3.0_unigene63882
Length: 192 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene63882
T |
|
Ace file of the UniGene sp_v3.0_unigene63882 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Calreticulin n=2 Tax=Pinaceae RepID=Q9FYV2_PINTA | - | - | 2.0e-27 | 95% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 95% |
| Sma3 | Calreticulin | - | - | 9.065e-40 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT1G56340; At1g08450; At1g09210; At1g56340; CAL1; CHLREDRAFT_78954; CRH; CRH1; CRH2; CRT; CRT1; CRT2; CRT3; CRTL; Crt1; EEF22; F13N6.20; F14G9.5; GSVIVT00010301001; GSVIVT00022619001; GSVIVT00025039001; GSVIVT00028103001; Gm crt-1; LOC_Os03g59264; LOC_Os0 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum lumen | GO:0005788 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | unfolded protein binding | GO:0051082 | Molecular Function | 0.0 | - |
| Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Calreticulin/calnexin | IPR001580 | - | 0.0 | - |
| Sma3 | Ribosomal protein L38e | IPR002675 | - | 0.0 | - |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | Calreticulin/calnexin, P | IPR009033 | - | 0.0 | - |
| Sma3 | Calreticulin | IPR009169 | - | 0.0 | - |
| Sma3 | Concanavalin A-like lectin/glucanase, subgroup | IPR013320 | - | 0.0 | - |
| Sma3 | Calreticulin/calnexin, conserved site | IPR018124 | - | 0.0 | - |
| Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G56340.1 | CRT1, CRT1a, AtCRT1a calreticulin 1a chr1:21090059-21092630 REVERSE LENGTH=425 | 2.0e-32 | 85% |
| RefSeq | Arabidopsis thaliana | NP_001031199.1 | calreticulin-1 [Arabidopsis thaliana] | 3.0e-32 | 85% |
| RefSeq | Populus trichocarpa | XP_002318957.1 | predicted protein [Populus trichocarpa] | 3.0e-31 | 83% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NUL6
Fln msg: Distance to subject end: 190 aas, your sequence is shorter than subject: 63 - 418
Fln protein:
V
Protein Length:
64
Fln nts:
T
Fln Alignment:
G5KS2UX02F4M1J___VPCETDQLTHVYTFILRPDATYSILIDNKDKQSGSLYKDWDLLPFSKTIKDPNAKKPEDWDD
A9NUL6_______________VPCETDQLTHVYTFILRPDATYSILIDNKDKQSGSLYKDWDLLP-PKTIKDPDAKKPEDWDD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
