|
||||||
|
UniGene Name: sp_v3.0_unigene63762
Length: 229 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene63762
A |
|
Ace file of the UniGene sp_v3.0_unigene63762
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q9SY02.1|PP301_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g02750 gb|AAD15348.1| hypothetical protein [Arabidopsis thaliana] emb|CAB77760.1| hypothetical protein | - | - | 4.0e-18 | 58% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 77% |
| Sma3 | Pentatricopeptide repeat-containing protein, putative | - | - | 1.359e-14 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g01510; At2g22070; At3g29230; At4g02750; At5g19020; At5g43790; At5g59600; At5g66520; B1358B12.23; F2I9.13; F2O15.13; GSVIVT00001532001; GSVIVT00001706001; GSVIVT00002423001; GSVIVT00003900001; GSVIVT00004236001; GSVIVT00006499001; GSVIVT00006886001; GS |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
| Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
| Sma3 | methylation | GO:0032259 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | Armadillo | IPR000225 | - | 0.0 | - |
| Sma3 | Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1 | IPR001578 | - | 0.0 | - |
| Sma3 | WD40 repeat | IPR001680 | - | 0.0 | - |
| Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF221 | IPR003864 | - | 0.0 | - |
| Sma3 | Putative methylase | IPR004557 | - | 0.0 | - |
| Sma3 | Methyltransferase small | IPR007848 | - | 0.0 | - |
| Sma3 | IPR008512 | - | 0.0 | - | |
| Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
| Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
| Sma3 | WD40/YVTN repeat-like-containing domain | IPR015943 | - | 0.0 | - |
| Sma3 | WD40-repeat-containing domain | IPR017986 | - | 0.0 | - |
| Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
| Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
| Sma3 | IPR019782 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G02750.1 | Tetratricopeptide repeat (TPR)-like superfamily protein chr4:1221116-1223461 REVERSE LENGTH=781 | 3.0e-23 | 58% |
| RefSeq | Arabidopsis thaliana | NP_192184.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 5.0e-23 | 58% |
| RefSeq | Populus trichocarpa | XP_002324074.1 | predicted protein [Populus trichocarpa] | 3.0e-24 | 62% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQA8
Fln msg: Distance to subject end: 202 aas, your sequence is shorter than subject: 75 - 795
Fln protein:
C
Protein Length:
76
Fln nts:
A
Fln Alignment:
G5KS2UX02FZMY2___ITFTAVLTACSHAALVDQGRQYFESMKSDYDLTPKLEQYACLVDLLGRAGHLHEAHDIINKMPLEPDA
B8LQA8_______________IAFTAILTACSHAGLVDQGLQYFQCMKSDYGLAPKLEHYACLVDLLGRAGHLDEANGIIKNMSLEPDA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
