UniGene Name: sp_v3.0_unigene63713
Length: 161 nt
![]() |
---|
>sp_v3.0_unigene63713
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Unassigned protein | - | - | 0.0 | - |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 69% |
Sma3 | Tetratricopeptide-like helical | - | - | 7.48e-13 | - |
Source | Gene names |
---|---|
Sma3 | At1g15510; At1g20230; At1g26900; At2g22410; At3g11460; At3g46790; At3g49140; At5g39350; At5g40410; At5g59600; At5g66520; B1032F05.19; CRR2; F14M13.19; F24K9.13; F2K15.2; F2O15.13; GSVIVT00000621001; GSVIVT00000887001; GSVIVT00002188001; GSVIVT00002423001; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Sma3 | chloroplast RNA processing | GO:0031425 | Biological Process | 0.0 | - |
Sma3 | polycistronic mRNA processing | GO:0031426 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Armadillo | IPR000225 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Adenosine/AMP deaminase domain | IPR001365 | - | 0.0 | - |
Sma3 | Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1 | IPR001578 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Immunoglobulin/major histocompatibility complex, conserved site | IPR003006 | - | 0.0 | - |
Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
Sma3 | Uncharacterised protein family UPF0497, trans-membrane plant | IPR006702 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Methyltransferase type 11 | IPR013216 | - | 0.0 | - |
Sma3 | Nuclear control of ATP synthase 2 | IPR013946 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G26900.1 | Pentatricopeptide repeat (PPR) superfamily protein chr1:9319756-9321474 REVERSE LENGTH=572 | 1.0e-17 | 66% |
RefSeq | Arabidopsis thaliana | NP_174012.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 2.0e-17 | 66% |
RefSeq | Populus trichocarpa | XP_002318526.1 | predicted protein [Populus trichocarpa] | 7.0e-19 | 69% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AD86
Fln msg: Distance to subject end: 179 aas, your sequence is shorter than subject: 53 - 514
Fln protein:
C
Protein Length:
54
Fln nts:
A
Fln Alignment:
G5KS2UX02GENHK___CMVDLLGRAGQLDEAYKLIQDMPLESDSSVWGALLGACRIHGNTQLGEYVAK
D5AD86_______________CMIDLLGRAGCLDEAENFINGMPVEPDVSVWGALLGACRIHGNTELAKRIAE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain