|
||||||
|
UniGene Name: sp_v3.0_unigene63698
Length: 236 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene63698
A |
|
Ace file of the UniGene sp_v3.0_unigene63698
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Tetratricopeptide-like helical [Medicago truncatula] | - | - | 8.0e-17 | 72% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 75% |
| Sma3 | Putative pentatricopeptide (PPR) repeat-containing protein | - | - | 7.372e-14 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g04840; At1g09410; At1g11290; At1g20230; At1g47580; At1g56690; At2g15690; At2g22070; At2g41080; At3g02010; At3g23330; At3g24000; At3g26782; At3g49170; At3g49710; At4g02750; At4g14050; At4g16835; At4g21065; At4g30700; At4g33170; At4g33990; At5g09950; At |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
| Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Sma3 | mRNA modification | GO:0016556 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G16835.1 | Tetratricopeptide repeat (TPR)-like superfamily protein chr4:9472763-9474803 FORWARD LENGTH=656 | 5.0e-22 | 73% |
| RefSeq | Arabidopsis thaliana | NP_680717.2 | tetratricopeptide repeat domain-containing protein [Arabidopsis thaliana] | 7.0e-22 | 73% |
| RefSeq | Populus trichocarpa | XP_002303271.1 | predicted protein [Populus trichocarpa] | 3.0e-22 | 73% |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AAE0
Fln msg: your sequence is shorter than subject: 52 - 246
Fln protein:
M
Protein Length:
53
Fln nts:
A
Fln Alignment:
G5KS2UX02JV5Q8___QIIKNLRVCGDCHSAISFISRIAPREIVVRDASRFHHFKKGKCSCGDYW
D5AAE0_______________RIIKNLRVCGDCHTATKFISKIVEREIIIRDANRFHHFKDGLCSCGDYW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
