UniGene Name: sp_v3.0_unigene63625
Length: 233 nt
UniGene Fasta |
---|
>sp_v3.0_unigene63625
A |
Ace file of the UniGene sp_v3.0_unigene63625 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Chloroplast elongation factor G n=2 Tax=Chlamydomonadales RepID=D8UC44_VOLCA | - | - | 3.0e-25 | 72% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 75% |
Source | Gene names |
---|---|
Sma3 | At1g62750; CHLREDRAFT_97127; EFG1; FUSA; FusA; GSVIVT00007283001; MICPUCDRAFT_26499; MICPUN_56116; OSJNBa0091D06.15; OSTLU_16297; Os04g0538100; OsI_16800; OsJ_15609; Ot07g04420; PHYPADRAFT_61310; POPTRDRAFT_711780; RCOM_1679710; THAPSDRAFT_25629; sco1; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | translation elongation factor activity | GO:0003746 | Molecular Function | 0.0 | - |
Sma3 | GTPase activity | GO:0003924 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
Sma3 | translational elongation | GO:0006414 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Translation elongation factor EFG/EF2, C-terminal | IPR000640 | - | 0.0 | - |
Sma3 | Protein synthesis factor, GTP-binding | IPR000795 | - | 0.0 | - |
Sma3 | Translation elongation factor EFTu/EF1A, domain 2 | IPR004161 | - | 0.0 | - |
Sma3 | Translation elongation factor EFG/EF2 | IPR004540 | - | 0.0 | - |
Sma3 | Small GTP-binding protein domain | IPR005225 | - | 0.0 | - |
Sma3 | Translation elongation factor EFG/EF2, domain IV | IPR005517 | - | 0.0 | - |
Sma3 | Ribosomal protein S5 domain 2-type fold, subgroup | IPR014721 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G62750.1 | ATSCO1, ATSCO1/CPEF-G, SCO1 Translation elongation factor EFG/EF2 protein chr1:23233622-23236321 REVERSE LENGTH=783 | 2.0e-27 | 71% |
RefSeq | Arabidopsis thaliana | NP_564801.1 | elongation factor EF-G [Arabidopsis thaliana] | 2.0e-27 | 71% |
RefSeq | Populus trichocarpa | XP_002304430.1 | predicted protein [Populus trichocarpa] | 2.0e-27 | 70% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKZ4
Fln msg: Distance to subject end: 130 aas, your sequence is shorter than subject: 77 - 785
Fln protein:
N
Protein Length:
78
Fln nts:
A
Fln Alignment:
G5KS2UX02GXRPS___YVHKKLVPVGSGQFADIRVRFEPGEPGSGFEFRSEIKGGVVPKEYIPGVTKGLEEMMGAGALAGFPVVDVTA
B8LKZ4_______________YVHKKQSG-GQGQFADVTVRFEPLEAGSGYEFKSEIKGGVVPKEYIPGVMKGLEECMSNGILAGYPVVDVRA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain