UniGene Name: sp_v3.0_unigene63593
Length: 220 nt
![]() |
---|
>sp_v3.0_unigene63593
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | JmjN domain containing protein | - | - | 1.0e-12 | 61% |
FL-Next | sp=Probable lysine-specific demethylase JMJ14; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 60% |
Sma3 | Jumonji domain protein | - | - | 2.345e-17 | - |
Source | Gene names |
---|---|
Sma3 | At1g08620; At1g30810/T17H7.10; At2g34880; At2g38950; At4g20400; GSVIVT00000415001; GSVIVT00002227001; GSVIVT00028571001; JMJ905; JMJ907; JMJ908; JMJ909; JMJ910; Os05g0196500; Os05g0302300; OsI_18782; OsI_19371; OsI_24556; OsJ_17446; OsJ_17964; P0617H07.8; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
Sma3 | GO:0045449 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ARID/BRIGHT DNA-binding domain | IPR001606 | - | 0.0 | - |
Sma3 | Zinc finger, PHD-type | IPR001965 | - | 0.0 | - |
Sma3 | Ribosomal protein L32p | IPR002677 | - | 0.0 | - |
Sma3 | JmjC domain | IPR003347 | - | 0.0 | - |
Sma3 | Transcription factor jumonji, JmjN | IPR003349 | - | 0.0 | - |
Sma3 | FY-rich, N-terminal | IPR003888 | - | 0.0 | - |
Sma3 | FY-rich, C-terminal | IPR003889 | - | 0.0 | - |
Sma3 | Zinc finger, C5HC2-type | IPR004198 | - | 0.0 | - |
Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
Sma3 | IPR013129 | - | 0.0 | - | |
Sma3 | Lysine-specific demethylase-like domain | IPR013637 | - | 0.0 | - |
Sma3 | FY-rich, C-terminal subgroup | IPR018516 | - | 0.0 | - |
Sma3 | FY-rich, N-terminal subgroup | IPR018518 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G08620.1 | PKDM7D Transcription factor jumonji (jmj) family protein / zinc finger (C5HC2 type) family protein chr1:2737554-2743370 FORWARD LENGTH=1209 | 9.0e-33 | 72% |
RefSeq | Arabidopsis thaliana | NP_172338.4 | transcription factor jumonji and C5HC2 type zinc finger domain-containing protein [Arabidopsis thaliana] | 1.0e-32 | 72% |
RefSeq | Populus trichocarpa | XP_002334907.1 | predicted protein [Populus trichocarpa] | 2.0e-28 | 72% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q8GUI6
Fln msg: Distance to subject end: 852 aas, your sequence is shorter than subject: 72 - 954
Fln protein:
C
Protein Length:
73
Fln nts:
A
Fln Alignment:
G5KS2UX02IXHZY___KVIARWRPDDGCRPMLDAAPVFYPNEEEFKDTLKYITGIRAAAEPYGICRIVPPPSWQPPCPLK
Q8GUI6_______________KITARWNPSEACRPLVDDAPIFYPTNEDFDDPLGYIEKLRSKAESYGICRIVPPVAWRPPCPLK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain