UniGene Name: sp_v3.0_unigene63433
Length: 233 nt
![]() |
---|
>sp_v3.0_unigene63433
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Cytochrome P450 750A1 n=1 Tax=Pinus taeda RepID=C75A1_PINTA | - | - | 3.0e-25 | 70% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 90% |
Sma3 | Flavonoid 3'-hydroxylase | - | - | 1.432e-19 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | EC:1.14.-.- | - | 9.678e-08 | - |
Source | Gene names |
---|---|
Sma3 | At2g40890; CYP71A1; CYP71D64; CYP736A4v1; CYP736A4v2; CYP736A8v1; CYP736A8v2; CYP736A8v4; CYP75; CYP750A1; CYP75B2; CYP98A1; CYP98A10; CYP98A11; CYP98A3; CYP98A37; F3'H; F3H1; GSVIVT00019414001; GSVIVT00019415001; GSVIVT00023306001; HT1; OJ1579_G03.1; Os0 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
Sma3 | microsome | GO:0005792 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | flavonoid 3'-monooxygenase activity | GO:0016711 | Molecular Function | 0.0 | - |
Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
Sma3 | p-coumarate 3-hydroxylase activity | GO:0046409 | Molecular Function | 0.0 | - |
Sma3 | coumarin biosynthetic process | GO:0009805 | Biological Process | 0.0 | - |
Sma3 | lignin biosynthetic process | GO:0009809 | Biological Process | 0.0 | - |
Sma3 | flavonoid biosynthetic process | GO:0009813 | Biological Process | 0.0 | - |
Sma3 | fruit ripening | GO:0009835 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
Sma3 | Aminoacyl-tRNA synthetase, class I, conserved site | IPR001412 | - | 0.0 | - |
Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
Sma3 | IPR017973 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G07990.1 | TT7, CYP75B1, D501 Cytochrome P450 superfamily protein chr5:2560437-2562859 FORWARD LENGTH=513 | 5.0e-19 | 51% |
RefSeq | Arabidopsis thaliana | NP_196416.1 | Flavonoid 3'-monooxygenase [Arabidopsis thaliana] | 6.0e-19 | 51% |
RefSeq | Populus trichocarpa | XP_002332769.1 | cytochrome P450 [Populus trichocarpa] | 1.0e-20 | 53% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PPU6
Fln msg: Distance to subject end: 61 aas, your sequence is shorter than subject: 77 - 526
Fln protein:
C
Protein Length:
78
Fln nts:
A
Fln Alignment:
G5KS2UX02HASJD___PLAVPHESVEAVTIEGYYIPKKTTVMVNVWAIARDPNVWGADASEFKPERFMEYEHVNLTDQSDFSMIPFGAGRRG
C0PPU6_______________PLMVPHESVEAVTIAGYYIPKKTTVMVNVWAIGRDPNVWGAYASKFKPERFMEYEQINLTDQSDFSMIPFGAGRRG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain