UniGene Name: sp_v3.0_unigene63414
Length: 181 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene63414
A |
Ace file of the UniGene sp_v3.0_unigene63414
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | 3-hydroxy-3-methylglutaryl coenzyme A reductase n=1 Tax=Taxus x media RepID=Q6WP38_9CONI | - | - | 1.0e-24 | 93% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 96% |
| Sma3 | 3-hydroxy-3-methylglutaryl coenzyme A reductase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Hydroxymethylglutaryl-CoA reductase (NADPH). | EC:1.1.1.34 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Terpenoid backbone biosynthesis | 00900 | 0.0 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 0.0 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | AHM1; AHM4; At1g76490; At2g17370; Cm-HMGR; F5J6.24; GSVIVT00002942001; GSVIVT00006002001; GSVIVT00036301001; GenHMG1; GenHMG2; HMG1; HMG2; HMG3; HMGR; HMGR1; HMGR2; HMGR3; HMGRL; HMGr; HbHMGR; LOC_Os08g40180; Os08g0512700; Os09g0492700; OsI_008506; OsI_08 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
| Sma3 | microsome | GO:0005792 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrial membrane | GO:0031966 | Cellular Component | 0.0 | - |
| Sma3 | plastid membrane | GO:0042170 | Cellular Component | 0.0 | - |
| Sma3 | hydroxymethylglutaryl-CoA reductase (NADPH) activity | GO:0004420 | Molecular Function | 0.0 | - |
| Sma3 | NADP binding | GO:0050661 | Molecular Function | 0.0 | - |
| Sma3 | coenzyme binding | GO:0050662 | Molecular Function | 0.0 | - |
| Sma3 | isoprenoid biosynthetic process | GO:0008299 | Biological Process | 0.0 | - |
| Sma3 | coenzyme A metabolic process | GO:0015936 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Hydroxymethylglutaryl-CoA reductase, class I/II | IPR002202 | - | 0.0 | - |
| Sma3 | Hydroxymethylglutaryl-CoA reductase, eukaryotic/arcaheal type | IPR004554 | - | 0.0 | - |
| Sma3 | Proteinase inhibitor I25, cystatin, conserved site | IPR018073 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G76490.1 | HMG1, HMGR1, AtHMGR1 hydroxy methylglutaryl CoA reductase 1 chr1:28695801-28698206 FORWARD LENGTH=642 | 2.0e-28 | 87% |
| RefSeq | Arabidopsis thaliana | NP_177775.2 | hydroxy methylglutaryl CoA reductase 1 [Arabidopsis thaliana] | 2.0e-28 | 87% |
| RefSeq | Populus trichocarpa | XP_002301898.1 | predicted protein [Populus trichocarpa] | 5.0e-30 | 91% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AAJ6
Fln msg: Distance to subject end: 71 aas, your sequence is shorter than subject: 59 - 305
Fln protein:
C
Protein Length:
60
Fln nts:
A
Fln Alignment:
G5KS2UX02G9MKH___NAHASNIVSAVFIATGQDPAQNIESSHCITMMEASNGGKDLHVSVTMPCIEVGTVGGG
D5AAJ6_______________NAHASNIVSAIFIATGQDPAQNVESSHCITMMEASNGGKDLHVSVTMPCIEVGTVGGG

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta