UniGene Name: sp_v3.0_unigene63395
Length: 141 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene63395
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Unassigned protein | - | - | 0.0 | - |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 90% |
Sma3 | Putative pentatricopeptide (PPR) repeat-containing protein | - | - | 7.46e-09 | - |
Source | Gene names |
---|---|
Sma3 | At1g08070; At1g09410; At1g11290; At1g18485; At1g20230; At1g47580; At1g56690; At1g68930; At2g15690; At2g22070; At3g02010; At3g03580; At3g12770; At3g24000; At3g26782; At3g49170; At3g49710; At3g57430; At4g02750; At4g14850; At4g16835; At4g30700; At4g33170; At |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | nucleotide binding | GO:0000166 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | DNA methylation | GO:0006306 | Biological Process | 0.0 | - |
Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
Sma3 | mRNA modification | GO:0016556 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G33990.1 | EMB2758 Tetratricopeptide repeat (TPR)-like superfamily protein chr4:16290141-16292612 REVERSE LENGTH=823 | 4.0e-22 | 81% |
RefSeq | Arabidopsis thaliana | NP_567948.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 5.0e-22 | 81% |
RefSeq | Populus trichocarpa | XP_002309359.1 | predicted protein [Populus trichocarpa] | 8.0e-22 | 83% |
![]() |
---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AAE0
Fln msg: your sequence is shorter than subject: 44 - 246
Fln protein:
R
Protein Length:
45
Fln nts:
T
Fln Alignment:
G5KS2UX02JGGRO___RVCGDCHNATKFISKVVKREIIVRDANRFHHFKDGLCSCGDYW
D5AAE0_______________RVCGDCHTATKFISKIVEREIIIRDANRFHHFKDGLCSCGDYW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain