UniGene Name: sp_v3.0_unigene63382
Length: 192 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene63382
A |
Ace file of the UniGene sp_v3.0_unigene63382
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Dihydrolipoyl dehydrogenase n=2 Tax=Picea sitchensis RepID=B8LLJ4_PICSI | - | - | 1.0e-15 | 88% |
| FL-Next | sp=Dihydrolipoyl dehydrogenase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 88% |
| Sma3 | Dihydrolipoyl dehydrogenase | - | - | 9.283e-34 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Dihydrolipoyl dehydrogenase. | EC:1.8.1.4 | - | 3.407e-33 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycolysis / Gluconeogenesis | 00010 | 3.407e-33 | % | |
| Sma3 | Citrate cycle (TCA cycle) | 00020 | 3.407e-33 | % | |
| Sma3 | Glycine, serine and threonine metabolism | 00260 | 3.407e-33 | % | |
| Sma3 | Valine, leucine and isoleucine degradation | 00280 | 3.407e-33 | % | |
| Sma3 | Pyruvate metabolism | 00620 | 3.407e-33 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 3.407e-33 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 3.407e-33 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 3.407e-33 | % | |
| Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 3.407e-33 | % | |
| Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 3.407e-33 | % | |
| Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 3.407e-33 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 3.407e-33 | % | |
| Sma3 | Metabolic pathways | 01100 | 3.407e-33 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 3.407e-33 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g48030; CHLREDRAFT_57890; DLDH; F21D18.28; GCSL; LPD; LPD1; OsI_18555; OsJ_17207; PDH E3; PHATRDRAFT_26432; PHYPADRAFT_106783; POPTRDRAFT_281171; T2J15.6; THAPSDRAFT_36716; lpd; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrial matrix | GO:0005759 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | dihydrolipoyl dehydrogenase activity | GO:0004148 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
| Sma3 | cell redox homeostasis | GO:0045454 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Mercuric reductase | IPR000815 | - | 0.0 | - |
| Sma3 | Pyridine nucleotide-disulphide oxidoreductase, NAD-binding domain | IPR001327 | - | 0.0 | - |
| Sma3 | Pyridine nucleotide-disulphide oxidoreductase, dimerisation | IPR004099 | - | 0.0 | - |
| Sma3 | Dihydrolipoamide dehydrogenase | IPR006258 | - | 0.0 | - |
| Sma3 | Pyridine nucleotide-disulphide oxidoreductase, class I, active site | IPR012999 | - | 0.0 | - |
| Sma3 | FAD-dependent pyridine nucleotide-disulphide oxidoreductase | IPR013027 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G48030.1 | mtLPD1 mitochondrial lipoamide dehydrogenase 1 chr1:17717432-17719141 REVERSE LENGTH=507 | 1.0e-13 | 62% |
| RefSeq | Arabidopsis thaliana | NP_175237.1 | dihydrolipoyl dehydrogenase 1 [Arabidopsis thaliana] | 1.0e-13 | 62% |
| RefSeq | Populus trichocarpa | XP_002311367.1 | precursor of dehydrogenase dihydrolipoamide dehydrogenase 1 [Populus trichocarpa] | 6.0e-13 | 60% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQQ4
Fln msg: Distance to subject end: 124 aas, your sequence is shorter than subject: 63 - 502
Fln protein:
C
Protein Length:
64
Fln nts:
A
Fln Alignment:
G5KS2UX02GCXZU___VKLDRMGRVEVDDHFRTNIPGIYAIGDVIPGPMLAHKAEDGLCLC
B8LQQ4_______________VKLDRMGRVEVDDHFRTNIPGIYAIGDVIPGPMLAHKAEEDGVAC

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta