UniGene Name: sp_v3.0_unigene63281
Length: 235 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene63281
A |
Ace file of the UniGene sp_v3.0_unigene63281 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Kinase-like protein pac.Erf.10 (Fragment) n=1 Tax=Platanus x acerifolia RepID=B6D3Q7_PLAAC | - | - | 2.0e-19 | 66% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 42% |
Sma3 | Kinase-like protein | - | - | 9.416e-13 | - |
Source | Gene names |
---|---|
Sma3 | At2g24130; GSVIVT00004217001; GSVIVT00005204001; GSVIVT00017170001; GSVIVT00018756001; GSVIVT00018759001; GSVIVT00018766001; GSVIVT00018948001; GSVIVT00025191001; GSVIVT00025215001; GSVIVT00025217001; GSVIVT00028428001; GSVIVT00029735001; GSVIVT0002973800 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | proton-transporting V-type ATPase, V0 domain | GO:0033179 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | hydrogen ion transmembrane transporter activity | GO:0015078 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | ATP synthesis coupled proton transport | GO:0015986 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | C2 calcium-dependent membrane targeting | IPR000008 | - | 0.0 | - |
Sma3 | ATPase, V0 complex, proteolipid subunit C | IPR000245 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Bulb-type lectin domain | IPR001480 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | Leucine-rich repeat, typical subtype | IPR003591 | - | 0.0 | - |
Sma3 | Apple-like | IPR003609 | - | 0.0 | - |
Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
Sma3 | Epidermal growth factor-like | IPR006210 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Copine | IPR010734 | - | 0.0 | - |
Sma3 | ATPase, V0 complex, proteolipid subunit C, eukaryotic | IPR011555 | - | 0.0 | - |
Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | C2 membrane targeting protein | IPR018029 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G24130.1 | Leucine-rich receptor-like protein kinase family protein chr2:10258148-10261220 FORWARD LENGTH=980 | 1.0e-21 | 59% |
RefSeq | Arabidopsis thaliana | NP_179990.1 | putative leucine-rich repeat transmembrane protein kinase [Arabidopsis thaliana] | 2.0e-21 | 59% |
RefSeq | Populus trichocarpa | XP_002309364.1 | predicted protein [Populus trichocarpa] | 4.0e-22 | 63% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LPH3
Fln msg: Distance to subject end: 136 aas, your sequence is shorter than subject: 78 - 360
Fln protein:
F
Protein Length:
79
Fln nts:
A
Fln Alignment:
G5KS2UX02II75V___FPLMPNGSLEKWLYPDDGEQSGLSLIQRLNIAIDIAQGVTYLHHHCFVQVIHCDLKPNNILLGEDM
B8LPH3_______________YDLMQNGSLDGILHSRSPNKVSLDWAARNKIALGSARGIAYLHHDCIPHIIHRDIKSSNILLDEEM
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain