UniGene Name: sp_v3.0_unigene63270
Length: 204 nt
![]() |
---|
>sp_v3.0_unigene63270
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | flag-tagged protein kinase domain of putative mitogen-activated protein kinase kinase kinase [synthetic construct] | - | - | 3.0e-28 | 93% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 95% |
Sma3 | Protein kinase atn1, putative | - | - | 2.766e-10 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 3.751e-06 | - |
Sma3 | Mitogen-activated protein kinase kinase kinase. | EC:2.7.11.25 | - | 5.808e-10 | - |
Source | Gene names |
---|---|
Sma3 | 16.EGGPLANT.9; 16.PETUNIA.10; AT4G31170; AT4g35780; AT4g38470; ATN1; At1g62400; At2g17700; At2g24360; At3g27560; At4g31170; At4g35780; At4g38470; At5g01850; At5g40540; At5g50180; B1015E06.24; CHLREDRAFT_105918; DPK1; DPK2; DPK3; DPK4; F20M13.30; F24O1.13; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | amino acid binding | GO:0016597 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | regulation of stomatal movement | GO:0010119 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Amino acid-binding ACT | IPR002912 | - | 0.0 | - |
Sma3 | Uncharacterised protein family UPF0497, trans-membrane plant | IPR006702 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | IPR015783 | - | 0.0 | - | |
Sma3 | Serine/threonine-protein kinase, ATN1-like | IPR015784 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Peptidase S10, serine carboxypeptidase, active site | IPR018202 | - | 0.0 | - |
Sma3 | Peptidase S26A, signal peptidase I, serine active site | IPR019756 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G31170.1 | Protein kinase superfamily protein chr4:15153499-15154846 REVERSE LENGTH=412 | 3.0e-36 | 93% |
RefSeq | Arabidopsis thaliana | NP_974649.1 | protein kinase family protein [Arabidopsis thaliana] | 4.0e-36 | 93% |
RefSeq | Populus trichocarpa | XP_002332108.1 | predicted protein [Populus trichocarpa] | 4.0e-36 | 93% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PTN3
Fln msg: Distance to subject end: 85 aas, your sequence is shorter than subject: 67 - 420
Fln protein:
M
Protein Length:
68
Fln nts:
A
Fln Alignment:
G5KS2UX02GJKXI___ADFGVARIEVQT-GMTPETGTYRWMAPEMIQHRPYNFKVDVYSFGIVLWELITGMLPFQNMTAVQA
C0PTN3_______________ADFGVARIEVQTEGMTPETGTYRWMAPEMIQHRSYNSKVDVYSFGIVLWELITGMLPFQNMTAVQA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain