UniGene Name: sp_v3.0_unigene63269
Length: 244 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene63269
C |
Ace file of the UniGene sp_v3.0_unigene63269 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | auxin response factor 10 [Arabidopsis thaliana] sp|Q9SKN5.1|ARFJ_ARATH RecName: Full=Auxin response factor 10 gb|AAG54000.1|AF336919_1 auxin response factor 10 [Arabidopsis thaliana] gb|AAK17141.1|AF325073_1 unknown protein [Arabidopsis thaliana] gb|AAD20 | - | - | 1.0e-32 | 82% |
| FL-Next | tr=Putative auxin response factor 3/4; Pinus pinaster (Maritime pine). | - | - | 0.0 | 62% |
| Sma3 | Auxin response factor, putative | - | - | 1.4013e-45 | - |
| Source | Gene names |
|---|---|
| Sma3 | ARF1; ARF10; ARF11; ARF12; ARF13; ARF14; ARF15; ARF16; ARF17; ARF18; ARF19; ARF2; ARF20; ARF21; ARF22; ARF23; ARF24; ARF25; ARF3; ARF4; ARF5; ARF6; ARF6A; ARF6B; ARF7; ARF7A; ARF7B; ARF8; ARF9; AT4G23980; At1g19220; At1g19850; At1g30330; At1g34310; At1g34 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
| Sma3 | transcription activator activity | GO:0016563 | Molecular Function | 0.0 | - |
| Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | pattern specification process | GO:0007389 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of cell proliferation | GO:0008285 | Biological Process | 0.0 | - |
| Sma3 | gravitropism | GO:0009630 | Biological Process | 0.0 | - |
| Sma3 | phototropism | GO:0009638 | Biological Process | 0.0 | - |
| Sma3 | anatomical structure morphogenesis | GO:0009653 | Biological Process | 0.0 | - |
| Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
| Sma3 | response to hormone stimulus | GO:0009725 | Biological Process | 0.0 | - |
| Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
| Sma3 | abscisic acid mediated signaling pathway | GO:0009738 | Biological Process | 0.0 | - |
| Sma3 | response to carbohydrate stimulus | GO:0009743 | Biological Process | 0.0 | - |
| Sma3 | blue light signaling pathway | GO:0009785 | Biological Process | 0.0 | - |
| Sma3 | auxin metabolic process | GO:0009850 | Biological Process | 0.0 | - |
| Sma3 | flower development | GO:0009908 | Biological Process | 0.0 | - |
| Sma3 | positive regulation of flower development | GO:0009911 | Biological Process | 0.0 | - |
| Sma3 | longitudinal axis specification | GO:0009942 | Biological Process | 0.0 | - |
| Sma3 | fruit dehiscence | GO:0010047 | Biological Process | 0.0 | - |
| Sma3 | vegetative phase change | GO:0010050 | Biological Process | 0.0 | - |
| Sma3 | leaf senescence | GO:0010150 | Biological Process | 0.0 | - |
| Sma3 | fruit development | GO:0010154 | Biological Process | 0.0 | - |
| Sma3 | abaxial cell fate specification | GO:0010158 | Biological Process | 0.0 | - |
| Sma3 | floral organ abscission | GO:0010227 | Biological Process | 0.0 | - |
| Sma3 | leaf vascular tissue pattern formation | GO:0010305 | Biological Process | 0.0 | - |
| Sma3 | lateral root primordium development | GO:0010386 | Biological Process | 0.0 | - |
| Sma3 | GO:0016481 | Biological Process | 0.0 | - | |
| Sma3 | regulation of anthocyanin biosynthetic process | GO:0031540 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of transcription, DNA-dependent | GO:0045892 | Biological Process | 0.0 | - |
| Sma3 | root development | GO:0048364 | Biological Process | 0.0 | - |
| Sma3 | leaf development | GO:0048366 | Biological Process | 0.0 | - |
| Sma3 | petal development | GO:0048441 | Biological Process | 0.0 | - |
| Sma3 | sepal development | GO:0048442 | Biological Process | 0.0 | - |
| Sma3 | ovule development | GO:0048481 | Biological Process | 0.0 | - |
| Sma3 | meristem development | GO:0048507 | Biological Process | 0.0 | - |
| Sma3 | developmental growth | GO:0048589 | Biological Process | 0.0 | - |
| Sma3 | root cap development | GO:0048829 | Biological Process | 0.0 | - |
| Sma3 | adventitious root development | GO:0048830 | Biological Process | 0.0 | - |
| Sma3 | cell division | GO:0051301 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aminotransferase, class-II, pyridoxal-phosphate binding site | IPR001917 | - | 0.0 | - |
| Sma3 | Smr protein/MutS2 C-terminal | IPR002625 | - | 0.0 | - |
| Sma3 | AUX/IAA protein | IPR003311 | - | 0.0 | - |
| Sma3 | B3 DNA binding domain | IPR003340 | - | 0.0 | - |
| Sma3 | Ribosomal protein S12/S23 | IPR006032 | - | 0.0 | - |
| Sma3 | Protein of unknown function DUF482 | IPR007434 | - | 0.0 | - |
| Sma3 | Auxin response factor | IPR010525 | - | 0.0 | - |
| Sma3 | Aux/IAA-ARF-dimerisation | IPR011525 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF1771 | IPR013899 | - | 0.0 | - |
| Sma3 | DNA methylase, N-4 cytosine-specific, conserved site | IPR017985 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G28350.1 | ARF10 auxin response factor 10 chr2:12114331-12116665 FORWARD LENGTH=693 | 2.0e-40 | 82% |
| RefSeq | Arabidopsis thaliana | NP_180402.1 | auxin response factor 10 [Arabidopsis thaliana] | 2.0e-40 | 82% |
| RefSeq | Populus trichocarpa | XP_002328300.1 | predicted protein [Populus trichocarpa] | 8.99998e-41 | 85% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: E1UHY2
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 635 aas, your sequence is shorter than subject: 80 - 919
Fln protein:
L
Protein Length:
81
Fln nts:
C
Fln Alignment:
G5KS2UX02H9XZN___LDYSSDPPVQTVLAKDVHGEVWKFRHIYRGTPRRHLLTTGWSTFVNQKKLVAGDAIVFLRSVTGELCVGVRRSTR
E1UHY2_______________LDYSQQRPSQELVAKDLHGREWRFRHIFRGQPRRHLLTTGWSVFVSYKRLVAGDAVLFLRDENGELRLGIRRASQ

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)