|
||||||
|
UniGene Name: sp_v3.0_unigene63234
Length: 154 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene63234
T |
|
Ace file of the UniGene sp_v3.0_unigene63234
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | phospholipid-translocating ATPase [Arabidopsis thaliana] sp|Q9LNQ4.2|ALA4_ARATH RecName: Full=Putative phospholipid-transporting ATPase 4; Short=AtALA4; AltName: Full=Aminophospholipid flippase 4 gb|AEE29599.1| phospholipid-translocating ATPase [Arabidops | - | - | 6.0e-12 | 66% |
| FL-Next | sp=Putative phospholipid-transporting ATPase 4; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 66% |
| Sma3 | Aminophospholipid ATPase | - | - | 7.329e-07 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phospholipid-translocating ATPase. | EC:3.6.3.1 | - | 1.312e-16 | - |
| Source | Gene names |
|---|---|
| Sma3 | ALA4; ALA5; ALA6; ALA7; At1g17500; At1g54280; At1g72700; At3g13900; F1L3.21; F20D21.10; F28P22.11; GSVIVT00034132001; MDC16.2; Os06g0565900; OsI_23406; OsJ_21731; P0513E02.24; P0567G03.5; POPTRDRAFT_299001; POPTRDRAFT_592804; RCOM_0654980; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | phospholipid-translocating ATPase activity | GO:0004012 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism | GO:0015662 | Molecular Function | 0.0 | - |
| Sma3 | ATP biosynthetic process | GO:0006754 | Biological Process | 0.0 | - |
| Sma3 | phospholipid transport | GO:0015914 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter | IPR001757 | - | 0.0 | - |
| Sma3 | Haloacid dehalogenase-like hydrolase | IPR005834 | - | 0.0 | - |
| Sma3 | ATPase, P-type, phospholipid-translocating, flippase | IPR006539 | - | 0.0 | - |
| Sma3 | ATPase, P-type, ATPase-associated domain | IPR008250 | - | 0.0 | - |
| Sma3 | HAD superfamily hydrolase-like, type 3 | IPR013200 | - | 0.0 | - |
| Sma3 | ATPase, P-type phosphorylation site | IPR018303 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G17500.1 | ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein chr1:6018757-6023201 FORWARD LENGTH=1216 | 2.0e-16 | 66% |
| RefSeq | Arabidopsis thaliana | NP_173193.2 | phospholipid-translocating ATPase [Arabidopsis thaliana] | 3.0e-16 | 66% |
| RefSeq | Populus trichocarpa | XP_002329063.1 | aminophospholipid ATPase, partial [Populus trichocarpa] | 3.0e-16 | 70% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9LNQ4
Fln msg: Distance to subject end: 20 aas, your sequence is shorter than subject: 50 - 1216
Fln protein:
D
Protein Length:
51
Fln nts:
T
Fln Alignment:
G5KS2UX02GZPJ8___DHHIIQEIKFLRKDVNDVKMWFRERAKAKQKT-IGFSARVDAKIRNLKERL
Q9LNQ4_______________DHHIIQEIKYYKRDVEDRRMWTRERTKAREKTKIGFTARVDAKIRHLRSKL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
