UniGene Name: sp_v3.0_unigene63155
Length: 202 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene63155
T |
Ace file of the UniGene sp_v3.0_unigene63155 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Cytosine-specific methyltransferase n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RVR7_PHYPA | - | - | 7.0e-15 | 80% |
| FL-Next | sp=DNA (cytosine-5)-methyltransferase 1; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 73% |
| Sma3 | Cytosine-specific methyltransferase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | DNA (cytosine-5-)-methyltransferase. | EC:2.1.1.37 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cysteine and methionine metabolism | 00270 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT4g13610; AT4g14140; ATHIM; At4g08990; At4g13610; At5g49160; BrMET1a; BrMET1b; CHLREDRAFT_205478; DMT1; DMT901; DMT902; GSVIVT00003628001; GSVIVT00003629001; GSVIVT00035341001; K21P3.3; LOC_Os03g58400; LesMET; MET1; MET1-2; METII; NtMET1; OJ1506_G02.17; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | DNA (cytosine-5-)-methyltransferase activity | GO:0003886 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | DNA methylation | GO:0006306 | Biological Process | 0.0 | - |
| Sma3 | regulation of gene expression by genetic imprinting | GO:0006349 | Biological Process | 0.0 | - |
| Sma3 | DNA mediated transformation | GO:0009294 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of flower development | GO:0009910 | Biological Process | 0.0 | - |
| Sma3 | zygote asymmetric cytokinesis in embryo sac | GO:0010069 | Biological Process | 0.0 | - |
| Sma3 | maintenance of DNA methylation | GO:0010216 | Biological Process | 0.0 | - |
| Sma3 | DNA methylation on cytosine within a CG sequence | GO:0010424 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Bromo adjacent homology (BAH) domain | IPR001025 | - | 0.0 | - |
| Sma3 | C-5 cytosine methyltransferase | IPR001525 | - | 0.0 | - |
| Sma3 | 2Fe-2S ferredoxin, iron-sulphur binding site | IPR006058 | - | 0.0 | - |
| Sma3 | DNA (cytosine-5)-methyltransferase 1, eukaryote | IPR017198 | - | 0.0 | - |
| Sma3 | DNA methylase, C-5 cytosine-specific, active site | IPR018117 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G49160.1 | MET1, MET2, METI, DDM2, DMT01, DMT1 methyltransferase 1 chr5:19932501-19938186 FORWARD LENGTH=1534 | 3.0e-18 | 73% |
| RefSeq | Arabidopsis thaliana | NP_199727.1 | DNA (cytosine-5)-methyltransferase 1 [Arabidopsis thaliana] | 3.0e-18 | 73% |
| RefSeq | Populus trichocarpa | XP_002305346.1 | DNA methyltransferase [Populus trichocarpa] | 9.0e-19 | 76% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P34881
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 228 aas, your sequence is shorter than subject: 67 - 1534
Fln protein:
F
Protein Length:
68
Fln nts:
T
Fln Alignment:
G5KS2UX02HBUKO___LRISIRLRFGVLQAGNYGVSQSRKRAFIWAASPQESLPEWPEPMHV
P34881_______________LEMGYQVRFGILEAGAYGVSQSRKRAFIWAAAPEEVLPEWPEPMHV

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)