|
||||||
|
UniGene Name: sp_v3.0_unigene63152
Length: 189 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene63152
A |
|
Ace file of the UniGene sp_v3.0_unigene63152
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | S-adenosylmethionine synthase 1 n=24 Tax=Tracheophyta RepID=METK1_VITVI | - | - | 2.0e-15 | 100% |
| FL-Next | sp=S-adenosylmethionine synthase 1; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 62% |
| Sma3 | S-adenosylmethionine synthetase | - | - | 2.982e-34 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Methionine adenosyltransferase. | EC:2.5.1.6 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cysteine and methionine metabolism | 00270 | 0.0 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | AMS1; AMS2; AdoMet4; AdoMet5; AdoMet6; AdoMet_e2; At2g36880; At3g17390; At4g01850; BYJ90; CHLRE_182408; GSVIVT00000624001; GSVIVT00022173001; GSVIVT00022531001; MAT; MATX; METK; METK-1; METK-2; METK1; METK2; METK3; METK4; METM; MGD8.23; MICPUCDRAFT_49687; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | methionine adenosyltransferase activity | GO:0004478 | Molecular Function | 0.0 | - |
| Sma3 | copper ion binding | GO:0005507 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | potassium ion binding | GO:0030955 | Molecular Function | 0.0 | - |
| Sma3 | cobalt ion binding | GO:0050897 | Molecular Function | 0.0 | - |
| Sma3 | one-carbon metabolic process | GO:0006730 | Biological Process | 0.0 | - |
| Sma3 | lignin biosynthetic process | GO:0009809 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | S-adenosylmethionine synthetase | IPR002133 | - | 0.0 | - |
| Sma3 | RNA polymerase Rpb7, N-terminal | IPR005576 | - | 0.0 | - |
| Sma3 | RNA polymerase III, subunit Rpc25 | IPR013238 | - | 0.0 | - |
| Sma3 | Heavy-metal-associated, conserved site | IPR017969 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G36880.1 | MAT3 methionine adenosyltransferase 3 chr2:15479721-15480893 REVERSE LENGTH=390 | 5.0e-17 | 96% |
| RefSeq | Arabidopsis thaliana | NP_001118458.1 | S-adenosylmethionine synthase 3 [Arabidopsis thaliana] | 6.0e-17 | 96% |
| RefSeq | Populus trichocarpa | XP_002319463.1 | s-adenosylmethionine synthetase 2 [Populus trichocarpa] | 8.0e-17 | 61% |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NUH8
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 326 aas, W1: There is no M at the beginning, your sequence is shorter than subject: 45 - 393
Fln protein:
D
Protein Length:
46
Fln nts:
A
Fln Alignment:
G5KS2UX02HCAQF___FTSESVNEGHPDKLCDQVSDAILDACLEQDPERQTW**SLEKLQL---------KLNIDYEK
A9NUH8_______________FTSESVNEGHPDKLCDQISDAILDACLEQDPESKVACETCTKTNMVMIFGEITTKANIDYEK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
