UniGene Name: sp_v3.0_unigene63120
Length: 190 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene63120
G |
Ace file of the UniGene sp_v3.0_unigene63120 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Ankyrin; Pentatricopeptide repeat [Medicago truncatula] | - | - | 4.0e-17 | 60% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 67% |
| Sma3 | EMB2261 putative | - | - | 1.658e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g06140; At1g20230; At1g53600; At1g68930; At1g74400; At2g29760; At3g49170; At4g02750; At4g13650; At5g09950; At5g40410; At5g43790; At5g48910; At5g66520; B1080A02.28; EMB2261; F18A5.40; F1M20.8; F22G10.27; F2K15.30; GSVIVT00000117001; GSVIVT00000673001; G |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
| Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G13650.1 | Pentatricopeptide repeat (PPR) superfamily protein chr4:7939611-7942898 REVERSE LENGTH=1064 | 3.0e-22 | 61% |
| RefSeq | Arabidopsis thaliana | NP_193101.2 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 4.0e-22 | 61% |
| RefSeq | Populus trichocarpa | XP_002333576.1 | predicted protein [Populus trichocarpa] | 9.0e-25 | 68% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P0W0
Fln msg: Distance to subject end: 200 aas, your sequence is shorter than subject: 63 - 370
Fln protein:
A
Protein Length:
64
Fln nts:
G
Fln Alignment:
G5KS2UX02IKNSO___CSHAGLVDEGCKYFKSMIQNYGITPREEHYNCMVDLLSRAGLLDKALNFINEMPFKPSAFVW
A9P0W0_______________CSHAGLVDEGRNYFDSMTRDHGISPKAEHYSCMVDLFGRAGCLDEALNFINQMPVEPNASVW

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)