UniGene Name: sp_v3.0_unigene63077
Length: 237 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene63077
A |
Ace file of the UniGene sp_v3.0_unigene63077 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | DUF659 domain containing protein | - | - | 3.0e-34 | 73% |
| FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 66% |
| Source | Gene names |
|---|---|
| Sma3 | GSVIVT00000858001; GSVIVT00001531001; GSVIVT00001874001; GSVIVT00002235001; GSVIVT00002367001; GSVIVT00003156001; GSVIVT00006112001; GSVIVT00007208001; GSVIVT00010563001; GSVIVT00012114001; GSVIVT00012683001; GSVIVT00013610001; GSVIVT00014165001; GSVIVT00 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | photosystem I | GO:0009522 | Cellular Component | 0.0 | - |
| Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
| Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | drug transmembrane transporter activity | GO:0015238 | Molecular Function | 0.0 | - |
| Sma3 | antiporter activity | GO:0015297 | Molecular Function | 0.0 | - |
| Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
| Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
| Sma3 | drug transmembrane transport | GO:0006855 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Sma3 | photosynthesis | GO:0015979 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G22220.1 | hAT transposon superfamily chr3:7839808-7842358 REVERSE LENGTH=761 | 9.0e-14 | 48% |
| RefSeq | Arabidopsis thaliana | NP_188861.2 | hAT dimerization domain-containing protein [Arabidopsis thaliana] | 1.0e-13 | 48% |
| RefSeq | Populus trichocarpa | XP_002329897.1 | predicted protein, partial [Populus trichocarpa] | 6.0e-16 | 57% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: A5B3G6
Fln msg: Distance to subject end: 503 aas, your sequence is shorter than subject: 78 - 1831
Fln protein:
A
Protein Length:
79
Fln nts:
A
Fln Alignment:
G5KS2UX02I88IB___ASDKVKDGHLLFQLLXXXXXXXXXXXXVQIITDIASNYVRAGRLLEEKHKTIFWTPCAAHCIDLMLEDIGKLDWV
A5B3G6_______________ASDTIKNGELMFKYLDEVVEEIGEENVVQVITDNASNYVNAGMRLMEKMSRLWWTPCAAHCIDLMLEDIGKLNFI

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)