UniGene Name: sp_v3.0_unigene63065
Length: 238 nt
![]() |
---|
>sp_v3.0_unigene63065
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Starch branching enzyme A n=1 Tax=Colocasia esculenta RepID=A5HSI0_COLES | - | - | 7.0e-18 | 59% |
FL-Next | sp=1,4-alpha-glucan-branching enzyme 2-2, chloroplastic/amyloplastic; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 82% |
Sma3 | Starch branching enzyme | - | - | 2.648e-22 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 1,4-alpha-glucan branching enzyme. | EC:2.4.1.18 | - | 4.103e-41 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Starch and sucrose metabolism | 00500 | 4.103e-41 | % | |
Sma3 | Metabolic pathways | 01100 | 4.103e-41 | % |
Source | Gene names |
---|---|
Sma3 | At2g36390; BE-II; CHLREDRAFT_142128; CHLREDRAFT_94079; F17C15_70; GSVIVT00021658001; H0321H01.10; IBE; OSTLU_45076; Os02g0528200; OsI_07480; OsI_15790; OsJ_06982; OsJ_14706; P0475F05.16; PHYPADRAFT_203522; POPTRDRAFT_589574; RBE3; RBE4; RCOM_0022940; RCOM |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | amyloplast | GO:0009501 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | 1,4-alpha-glucan branching enzyme activity | GO:0003844 | Molecular Function | 0.0 | - |
Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
Sma3 | cation binding | GO:0043169 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Sma3 | amylopectin biosynthetic process | GO:0010021 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycoside hydrolase, family 13, N-terminal | IPR004193 | - | 0.0 | - |
Sma3 | Glycosyl hydrolase, family 13, catalytic domain | IPR006047 | - | 0.0 | - |
Sma3 | Alpha-amylase, C-terminal all beta | IPR006048 | - | 0.0 | - |
Sma3 | FBD | IPR006566 | - | 0.0 | - |
Sma3 | Leucine-rich repeat 2 | IPR013101 | - | 0.0 | - |
Sma3 | Glycosyl hydrolase, family 13, all-beta | IPR013780 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, subgroup, catalytic domain | IPR013781 | - | 0.0 | - |
Sma3 | Immunoglobulin-like fold | IPR013783 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G03650.1 | SBE2.2 starch branching enzyme 2.2 chr5:931924-937470 FORWARD LENGTH=805 | 7.0e-22 | 82% |
RefSeq | Arabidopsis thaliana | NP_195985.3 | 1,4-alpha-glucan branching enzyme [Arabidopsis thaliana] | 9.0e-22 | 82% |
RefSeq | Populus trichocarpa | XP_002326414.1 | predicted protein [Populus trichocarpa] | 2.0e-21 | 82% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9LZS3
Fln msg: Distance to subject end: 131 aas, your sequence is shorter than subject: 78 - 805
Fln protein:
C
Protein Length:
79
Fln nts:
A
Fln Alignment:
G5KS2UX02GW8CA___MIHGLFPQAITIGEDVSGMPTFSRSVQDGGVGFDYRLHMAVADKWID
Q9LZS3_______________MIHGLYPEAITVGEDVSGMPTFCIPVQDGGVGFDYRLHMAIADKWIE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain