|
||||||
|
UniGene Name: sp_v3.0_unigene63061
Length: 246 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene63061
A |
|
Ace file of the UniGene sp_v3.0_unigene63061
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Serine/threonine protein kinase PBS1 n=3 Tax=Malpighiales RepID=B9GMP8_POPTR | - | - | 6.0e-38 | 94% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 91% |
| Sma3 | Receptor serine-threonine protein kinase, putative | - | - | 1.215e-35 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 1.663e-17 | - |
| Sma3 | Mitogen-activated protein kinase kinase kinase. | EC:2.7.11.25 | - | 3.285e-07 | - |
| Source | Gene names |
|---|---|
| Sma3 | 673I14.2; APK2a; APK2b; AT4g13190; At1g07870; At1g14370; At1g14370/F14L17.14; At1g20650; At1g24030; At1g61590; At1g76370; At2g02800; At2g02800/T20F6.6; At2g28590; At3g01300; At3g02810; At3g07070; At3g20530; At3g24790; At3g26940; At4g13190; At5g02800; At5g |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | structural constituent of cell wall | GO:0005199 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain | IPR000194 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | NB-ARC | IPR002182 | - | 0.0 | - |
| Sma3 | Pistil-specific extensin-like protein | IPR003882 | - | 0.0 | - |
| Sma3 | Zinc finger, C2H2 | IPR007087 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
| Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G18610.1 | Protein kinase superfamily protein chr5:6192736-6195371 FORWARD LENGTH=513 | 0.0 | 94% |
| RefSeq | Arabidopsis thaliana | NP_197362.1 | protein kinase family protein [Arabidopsis thaliana] | 0.0 | 94% |
| RefSeq | Populus trichocarpa | XP_002297857.1 | serine/threonine protein kinase PBS1 [Populus trichocarpa] | 0.0 | 94% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AAA3
Fln msg: Distance to subject end: 274 aas, your sequence is shorter than subject: 81 - 458
Fln protein:
M
Protein Length:
82
Fln nts:
A
Fln Alignment:
G5KS2UX02IZIEK___FGRVYKGCLESTGQIVAVKQLDRNGLQGNREFLVEVLMLSLLHHPNLVSLIGYCADGDQRLLVYEYLPLGSLEDHLHDL
D5AAA3_______________FGRVYRGRLESTGQAVAVKQLDRNGVQGNREFLVEVLMLSLLHHDNLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
