UniGene Name: sp_v3.0_unigene63040
Length: 243 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene63040
A |
Ace file of the UniGene sp_v3.0_unigene63040 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q9LND4.1|PPR14_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g06140, mitochondrial; Flags: Precursor gb|AAF80137.1|AC024174_19 Contains similarity to a hypothetical | - | - | 5.0e-21 | 58% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 67% |
Sma3 | Pentatricopeptide repeat-containing protein, putative | - | - | 2.108e-14 | - |
Source | Gene names |
---|---|
Sma3 | At1g06140; At1g20230; At1g53600; At2g01510; At2g13600; At2g22070; At2g36730; At3g16610; At3g62890; At4g01030; At4g02750; At4g14170; At4g14820; At4g16835; At4g19191; At5g15300; At5g19020; At5g66520; DYW10; F13K3.13; F22G10.27; F26K9_320; F2I9.13; F3I3.50; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Sma3 | mitosis | GO:0007067 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Sma3 | methylation | GO:0032259 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G06140.1 | Pentatricopeptide repeat (PPR) superfamily protein chr1:1864796-1866472 FORWARD LENGTH=558 | 9.0e-27 | 58% |
RefSeq | Arabidopsis thaliana | NP_172104.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 1.0e-26 | 58% |
RefSeq | Populus trichocarpa | XP_002318526.1 | predicted protein [Populus trichocarpa] | 1.0e-25 | 59% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AB53
Fln msg: Distance to subject end: 22 aas, your sequence is shorter than subject: 81 - 232
Fln protein:
N
Protein Length:
82
Fln nts:
A
Fln Alignment:
G5KS2UX02GWIOC___NSVTFVGVLFACGHAGLVDHGWKYFHSMSQDYNIIPTIEHYCCMVDLLGRAGNLYEAQNFISSMPLEPDAAVMGSFLSA
D5AB53_______________NQVTFVGVLSACCHAGLVSEGRQYFNSMSVDYHITPVMEHYCCMVDLLGRTGCLDEAHDFINKMPIEPDTAVWQSLLGA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain