|
||||||
|
UniGene Name: sp_v3.0_unigene63028
Length: 156 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene63028
A |
|
Ace file of the UniGene sp_v3.0_unigene63028
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Ubiquitin carboxyl-terminal hydrolase n=1 Tax=Ricinus communis RepID=B9SWA7_RICCO | - | - | 4.0e-20 | 90% |
| FL-Next | sp=Ubiquitin carboxyl-terminal hydrolase 5; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 86% |
| Sma3 | Ubiquitin carboxyl-terminal hydrolase | - | - | 4.43e-24 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ubiquitin thiolesterase. | EC:3.1.2.15 | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4G10590; At1g32850; At2g40930; At4g10570; At4g10590; At5g22030; CHLREDRAFT_108251; F3H7.5; F9L11.5; GSVIVT00000496001; GSVIVT00017461001; GSVIVT00027189001; LOC_Os10g07270; LOC_Os12g42600; OJ1714_H10.117; OSJNBa0050E08.11; OSJNBb0057I13.30; OSTLU_39993; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | transcription factor TFIID complex | GO:0005669 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
| Sma3 | cysteine-type peptidase activity | GO:0008234 | Molecular Function | 0.0 | - |
| Sma3 | queuine tRNA-ribosyltransferase activity | GO:0008479 | Molecular Function | 0.0 | - |
| Sma3 | transcription initiation factor activity | GO:0016986 | Molecular Function | 0.0 | - |
| Sma3 | transcription initiation, DNA-dependent | GO:0006352 | Biological Process | 0.0 | - |
| Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
| Sma3 | queuosine biosynthetic process | GO:0008616 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 | IPR001394 | - | 0.0 | - |
| Sma3 | Crotonase, core | IPR001753 | - | 0.0 | - |
| Sma3 | Queuine/other tRNA-ribosyltransferase | IPR002616 | - | 0.0 | - |
| Sma3 | Transcription initiation factor TFIID | IPR003228 | - | 0.0 | - |
| Sma3 | Queuine tRNA-ribosyltransferase | IPR004803 | - | 0.0 | - |
| Sma3 | Endonuclease/exonuclease/phosphatase | IPR005135 | - | 0.0 | - |
| Sma3 | Ureohydrolase | IPR006035 | - | 0.0 | - |
| Sma3 | Peptidase C19, ubiquitin-specific peptidase, DUSP domain | IPR006615 | - | 0.0 | - |
| Sma3 | Histone-fold | IPR009072 | - | 0.0 | - |
| Sma3 | IPR010460 | - | 0.0 | - | |
| Sma3 | Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2, conserved site | IPR018200 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G40930.1 | UBP5, ATUBP5, PDE323 ubiquitin-specific protease 5 chr2:17076714-17082192 REVERSE LENGTH=924 | 7.0e-25 | 86% |
| RefSeq | Arabidopsis thaliana | NP_565944.1 | ubiquitin carboxyl-terminal hydrolase 5 [Arabidopsis thaliana] | 9.0e-25 | 86% |
| RefSeq | Populus trichocarpa | XP_002335895.1 | predicted protein [Populus trichocarpa] | 2.0e-27 | 90% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: O22207
Fln msg: Distance to subject end: 97 aas, your sequence is shorter than subject: 51 - 924
Fln protein:
M
Protein Length:
52
Fln nts:
A
Fln Alignment:
G5KS2UX02HA5NW___FLREEPLVPEEMWYCPCCKEHRQASKKLDLWRLPEVLVVHLKRFLYSRSM
O22207_______________FLREEPLVPDEMWFCPQCNERRQASKKLDLWRLPEVLVIHLKRFSYSRSM
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
