UniGene Name: sp_v3.0_unigene63004
Length: 213 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene63004
G |
Ace file of the UniGene sp_v3.0_unigene63004 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Ribulose bisphosphate carboxylase small chain n=1 Tax=Picea sitchensis RepID=C0PPY1_PICSI | - | - | 2.0e-17 | 97% |
| FL-Next | sp=Ribulose bisphosphate carboxylase small chain; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 97% |
| Sma3 | Ribulose bisphosphate carboxylase small chain | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ribulose-bisphosphate carboxylase. | EC:4.1.1.39 | - | 1.092e-19 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glyoxylate and dicarboxylate metabolism | 00630 | 1.092e-19 | % | |
| Sma3 | Carbon fixation in photosynthetic organisms | 00710 | 1.092e-19 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.092e-19 | % |
| Source | Gene names |
|---|---|
| Sma3 | ATS1A; ATS1B; ATS2B; ATS3B; At1g67090; At5g38410; At5g38420; At5g38430; LOC_Os12g19394; LOC_Os12g19470; MXI10.14; MXI10.15; Os12g0291100; Os12g0291400; Os12g0292400; OsI_018348; OsI_38042; OsI_38046; OsJ_17688; OsJ_35811; OsJ_35814; OsJ_35820; POPTRDRAFT_ |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast ribulose bisphosphate carboxylase complex | GO:0009573 | Cellular Component | 0.0 | - |
| Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | ribulose-bisphosphate carboxylase activity | GO:0016984 | Molecular Function | 0.0 | - |
| Sma3 | photorespiration | GO:0009853 | Biological Process | 0.0 | - |
| Sma3 | carbon fixation | GO:0015977 | Biological Process | 0.0 | - |
| Sma3 | reductive pentose-phosphate cycle | GO:0019253 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ribulose bisphosphate carboxylase small chain, domain | IPR000894 | - | 0.0 | - |
| Sma3 | Proteinase inhibitor I3, Kunitz legume | IPR002160 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G67090.1 | RBCS1A ribulose bisphosphate carboxylase small chain 1A chr1:25048465-25049249 REVERSE LENGTH=180 | 3.0e-16 | 69% |
| RefSeq | Arabidopsis thaliana | NP_176880.1 | ribulose bisphosphate carboxylase small chain 1A [Arabidopsis thaliana] | 3.0e-16 | 69% |
| RefSeq | Populus trichocarpa | XP_002305162.1 | predicted protein [Populus trichocarpa] | 1.0e-15 | 72% |
Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: C0PPY1
Fln msg: your sequence is shorter than subject: 45 - 136
Fln protein:
T
Protein Length:
46
Fln nts:
G
Fln Alignment:
G5KS2UX02GNBOF___TEASQVINEVNECAKAYPKAFIRVIGFDNVRQVQCISFIVHKPE
C0PPY1_______________TEASQVLNEVNECAKAYPKAFIRVIGFDNVRQVQCISFIVHKPE

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)