UniGene Name: sp_v3.0_unigene62960
Length: 228 nt
UniGene Fasta |
---|
>sp_v3.0_unigene62960
A |
Ace file of the UniGene sp_v3.0_unigene62960 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | DNA-directed RNA polymerase D subunit 2a n=3 Tax=Arabidopsis RepID=RPD2A_ARATH | - | - | 2.0e-13 | 72% |
FL-Next | sp=DNA-directed RNA polymerase D subunit 2a; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 57% |
Sma3 | DNA-directed RNA polymerase | - | - | 4.708e-12 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | DNA-directed RNA polymerase. | EC:2.7.7.6 | - | 3.481e-11 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Purine metabolism | 00230 | 3.481e-11 | % | |
Sma3 | Pyrimidine metabolism | 00240 | 3.481e-11 | % | |
Sma3 | Metabolic pathways | 01100 | 3.481e-11 | % |
Source | Gene names |
---|---|
Sma3 | At3g18090; At3g23780; B0414F07.4; GSVIVT00032775001; NRPD2a; OSJNBa0063C18.1; OSJNBb0079B02.6; Os04g0641000; OsI_17620; OsJ_16357; POPTRDRAFT_737361; RCOM_0920920; RPD2; RPD2a; RPD2b; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | DNA-directed RNA polymerase IV complex | GO:0000418 | Cellular Component | 0.0 | - |
Sma3 | nuclear heterochromatin | GO:0005720 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | DNA-directed RNA polymerase activity | GO:0003899 | Molecular Function | 0.0 | - |
Sma3 | ribonucleoside binding | GO:0032549 | Molecular Function | 0.0 | - |
Sma3 | DNA methylation | GO:0006306 | Biological Process | 0.0 | - |
Sma3 | GO:0006350 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | DNA-directed RNA polymerase, subunit 2, domain 6 | IPR007120 | - | 0.0 | - |
Sma3 | RNA polymerase, beta subunit, conserved site | IPR007121 | - | 0.0 | - |
Sma3 | RNA polymerase Rpb2, domain 7 | IPR007641 | - | 0.0 | - |
Sma3 | RNA polymerase Rpb2, domain 2 | IPR007642 | - | 0.0 | - |
Sma3 | RNA polymerase, beta subunit, protrusion | IPR007644 | - | 0.0 | - |
Sma3 | RNA polymerase Rpb2, domain 3 | IPR007645 | - | 0.0 | - |
Sma3 | RNA polymerase Rpb2, domain 4 | IPR007646 | - | 0.0 | - |
Sma3 | RNA polymerase Rpb2, domain 5 | IPR007647 | - | 0.0 | - |
Sma3 | DNA-directed RNA polymerase, subunit 2 | IPR015712 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G23780.1 | NRPD2A, DRD2, NRPD2, DMS2, NRPE2 nuclear RNA polymerase D2A chr3:8567971-8573819 REVERSE LENGTH=1172 | 8.0e-16 | 72% |
RefSeq | Arabidopsis thaliana | NP_001189957.1 | nuclear RNA polymerase D2A [Arabidopsis thaliana] | 1.0e-15 | 72% |
RefSeq | Populus trichocarpa | XP_002324332.1 | predicted protein [Populus trichocarpa] | 2.0e-15 | 72% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9LK40
Fln msg: ERROR#3, very serious frame error, Overlapping hits, possible frame ERROR between 100 and 100, Distance to subject end: 242 aas, your sequence is shorter than subject: 76 - 1172
Fln protein:
M
Protein Length:
77
Fln nts:
A
Fln Alignment:
G5KS2UX02GFB3M___SDGNFSLKLKHTEKGRVDQVVLATNDDGKKIARVRLREVRSPCLGNKFSSMHGQKGVVGFIEEQ
Q9LK40_______________SGADHSIKLKHTERGIVQKVVLSSNDEGKNFAAVSLRQVRSPCLGDKFSSMHGQKGVLGYLEEQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain