SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene62867

Length: 311 nt

UniGene Fasta

>sp_v3.0_unigene62867
AATGTTTTCGAGTTCCTGGTCATGACTTTTGGGTTGACCAACACCCTTGCCACTTTTCTGTCATGCATGAACGATGTGTTCAGGCGATAGTTGAGGAGATTTGTGCTAGTTTTCTTCGATGACATCCTGATCTACAACAGGACGTGGGAGGAGCACCTACAACACCTAGAGACGGTGTTGCGCATTTTAGAGGAGCAACAATTCTACGCCAAGTTGTCCGAGTGTGAATTTTGGATTGACAGAGATGCTTTACTTGGGACACATCATTGGCACAGATACGGTCAAGGTGCATGATGAGAAGATCAGGGTCA

Ace file of the UniGene sp_v3.0_unigene62867

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Retrotransposon protein, putative, Ty3-gypsy subclass n=2 Tax=Oryza sativa RepID=Q10GH3_ORYSJ	-	-	1.0e-13	47%
FL-Next	tr=Gag-pol polyprotein; Solanum lycopersicum (Tomato) (Lycopersicon esculentum).	-	-	0.0	54%
Sma3	Retrotransposon protein, putative, Ty3-gypsy subclass	-	-	0.0	-

Source	Gene names
Sma3	At2g06470; B1159F04.11; B1168G10.5; F23H6.1; H0502G05.12; H0613A10.2; H0820C10.2; LOC_Os03g04860; LOC_Os03g05350; LOC_Os03g21350; LOC_Os03g26750; LOC_Os03g26760; LOC_Os03g29790; LOC_Os03g41770; LOC_Os03g41960; LOC_Os03g42950; LOC_Os03g48990; LOC_Os10g0325

Source	GOs	Term	Type	Identity
Sma3	chromatin	GO:0000785	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	chromatin binding	GO:0003682	Molecular Function	-
Sma3	RNA binding	GO:0003723	Molecular Function	-
Sma3	actin binding	GO:0003779	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	carbonate dehydratase activity	GO:0004089	Molecular Function	-
Sma3	aspartic-type endopeptidase activity	GO:0004190	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	sugar binding	GO:0005529	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	RNA-dependent DNA replication	GO:0006278	Biological Process	-
Sma3	chromatin assembly or disassembly	GO:0006333	Biological Process	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	proteolysis	GO:0006508	Biological Process	-
Sma3	cytoskeleton organization	GO:0007010	Biological Process	-
Sma3	neuropeptide signaling pathway	GO:0007218	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-
Sma3	carbon utilization	GO:0015976	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Reverse transcriptase	IPR000477	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Chromo domain/shadow	IPR000953	-	-
Sma3	Legume lectin, alpha chain, conserved site	IPR000985	-	-
Sma3	Legume lectin domain	IPR001220	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Carbonic anhydrase	IPR001765	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Peptidase aspartic, active site	IPR001969	-	-
Sma3	Peptidase A2A, retrovirus, catalytic	IPR001995	-	-
Sma3	FMRFamide-related peptide-like	IPR002544	-	-
Sma3	Retrotransposon gag protein	IPR005162	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Domain of unknown function DUF834	IPR008552	-	-
Sma3	Peptidase aspartic, catalytic	IPR009007	-	-
Sma3		IPR013084	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	Retroviral aspartyl protease	IPR013242	-	-
Sma3	Concanavalin A-like lectin/glucanase, subgroup	IPR013320	-	-
Sma3	Zinc finger, H2C2-type, histone UAS binding	IPR015416	-	-
Sma3	Carbonic anhydrase, prokaryotic-like, conserved site	IPR015892	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	Peroxidase, active site	IPR019794	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: tr_plants

Fln subject: E6Y5Q2

Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 365 aas, your sequence is shorter than subject: 98 - 624

Fln protein: NVFEFLVMTFGLTNTLATFLSCMNDVFRR*LRRFVLVFFDDILIYNRTWEEHLQHLETVLRILEEQQFYAKLSECEFWIDRDALLGTHHWHRYGQGA*

Protein Length: 99

Fln nts: AATGTTTTCGAGTTCCTGGTCATGACTTTTGGGTTGACCAACACCCTTGCCACTTTTCTGTCATGCATGAACGATGTGTTCAGGCGATAGTTGAGGAGATTTGTGCTAGTTTTCTTCGATGACATCCTGATCTACAACAGGACGTGGGAGGAGCACCTACAACACCTAGAGACGGTGTTGCGCATTTTAGAGGAGCAACAATTCTACGCCAAGTTGTCCGAGTGTGAATTTTGGATTGACAGAGATGCTTTACTTGGGACACATCATTGGCACAGATACGGTCAAGGTGCATGATGAGAAGATCAGGGTCA

Fln Alignment:

G5KS2UX02F7V8M___FEFLVMTFGLTNTLATFLSCMNXXXXXXXXXXXXXXXXXILIYNRTWEEHLQHLETVLRILEEQQFYAKLSECEFWIDRDALLG
E6Y5Q2_______________YEFVVMSFGLTNAPAAFMSLMNGIFKPYLDLFVIVFIDDILIYSKSKEEHEEHLRMVLEMLREKKLYAKFSKCEFWLDTVSFLG

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain