UniGene Name: sp_v3.0_unigene62832
Length: 183 nt
UniGene Fasta |
---|
>sp_v3.0_unigene62832
A |
Ace file of the UniGene sp_v3.0_unigene62832 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | DUF659 domain containing protein | - | - | 8.0e-25 | 74% |
FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 61% |
Source | Gene names |
---|---|
Sma3 | GSVIVT00000858001; GSVIVT00001531001; GSVIVT00001874001; GSVIVT00002235001; GSVIVT00002367001; GSVIVT00003156001; GSVIVT00006112001; GSVIVT00014165001; GSVIVT00019252001; GSVIVT00022003001; GSVIVT00022661001; GSVIVT00023458001; GSVIVT00024230001; GSVIVT00 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | photosystem I | GO:0009522 | Cellular Component | 0.0 | - |
Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | photosynthesis | GO:0015979 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G36095.1 | DNA binding chr1:13491370-13492725 REVERSE LENGTH=301 | 6.0e-11 | 52% |
RefSeq | Arabidopsis thaliana | NP_174842.1 | DNA binding protein [Arabidopsis thaliana] | 8.0e-11 | 52% |
RefSeq | Populus trichocarpa | XP_002329897.1 | predicted protein, partial [Populus trichocarpa] | 3.0e-12 | 59% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: A5AYX3
Fln msg: Distance to subject end: 422 aas, your sequence is shorter than subject: 60 - 633
Fln protein:
C
Protein Length:
61
Fln nts:
A
Fln Alignment:
G5KS2UX02IMNDA___FQLLXXXXXXXXXXXXXQIITDNASDYVLAGKLLEEKHTTIFWNPCVAHCIYLMLEDVG
A5AYX3_______________FELLDKWVEQVGEKNVIQVITDNHSSYVMAGRLLELKRSYLYWTPCVAHCLDLMLEDIG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain