UniGene Name: sp_v3.0_unigene62811
Length: 241 nt
UniGene Fasta |
---|
>sp_v3.0_unigene62811
A |
Ace file of the UniGene sp_v3.0_unigene62811 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Putative retroelement n=1 Tax=Oryza sativa Japonica Group RepID=Q94I65_ORYSJ | - | - | 6.0e-19 | 58% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 60% |
Sma3 | Retrotransposon protein, putative, Ty1-copia subclass | - | - | 2.497e-35 | - |
Source | Gene names |
---|---|
Sma3 | B1003C08.12; B1065G12.28; BA4; F19K19.5; LOC_Os03g06540; LOC_Os03g20080; LOC_Os03g24620; LOC_Os03g30860; LOC_Os03g36610; LOC_Os03g56990; LOC_Os03g64080; LOC_Os10g01750; LOC_Os10g04640; LOC_Os10g18440; LOC_Os10g30510; LOC_Os10g40800; LOC_Os11g07980; LOC_Os |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nuclear pore | GO:0005643 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | protein transporter activity | GO:0008565 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
Sma3 | protein import into nucleus, docking | GO:0000059 | Biological Process | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
Sma3 | Importin-beta, N-terminal | IPR001494 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Haem peroxidase, plant/fungal/bacterial | IPR002016 | - | 0.0 | - |
Sma3 | Ankyrin repeat | IPR002110 | - | 0.0 | - |
Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | HAT dimerisation | IPR008906 | - | 0.0 | - |
Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
Sma3 | IPR013084 | - | 0.0 | - | |
Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
Sma3 | Exportin-1/Importin-beta-like | IPR013598 | - | 0.0 | - |
Sma3 | CRM1 C-terminal domain | IPR014877 | - | 0.0 | - |
Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
Sma3 | IPR017973 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G23160.1 | CRK8 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 chr4:12129485-12134086 FORWARD LENGTH=1262 | 2.0e-17 | 53% |
RefSeq | Arabidopsis thaliana | NP_194047.2 | cysteine-rich receptor-like protein kinase 8 [Arabidopsis thaliana] | 3.0e-17 | 53% |
Full-Lengther Next Prediction |
---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LKV8
Fln msg: Distance to subject end: 276 aas, atg_distance in limit (1-15): atg_distance = 8, Unexpected STOP codon in 5 prime region, your sequence is shorter than subject: 73 - 363
Fln protein:
K
Protein Length:
74
Fln nts:
A
Fln Alignment:
G5KS2UX02F7D56___KNDT*KLVDPLFGTKPIRCKWVYKNKYKADGSLDKHKARLVAKGSAQMEGVDYEEAFSPTTKWATIRTLFALAAQNGW
B8LKV8_______________KNDTWDLVDLPKEKECISVKWVYKTKYKANGELDKHKARLVAKGFAQEYGVDYNETFAPVARLDTIRMVLAIAAQHNW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain