UniGene Name: sp_v3.0_unigene62799
Length: 225 nt
![]() |
---|
>sp_v3.0_unigene62799
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | MYB-like protein (Fragment) n=4 Tax=rosids RepID=Q2MV91_VITVI | - | - | 2.0e-18 | 82% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 69% |
Sma3 | R2r3-myb transcription factor, putative | - | - | 1.619e-14 | - |
Source | Gene names |
---|---|
Sma3 | ATR1; At1g74080; At2g16720; At3g13540; At4g34990; At4g38620; At5g49330; At5g54230; At5g54230/MDK4.5; At5g60890; B1053A04.9; B59J16.6; C1; C1-B73; C1-I; DcMYB3-1; DcMYB3-2; DcMYB5; F20M13.180; F2P9.5; FcMYB251; FcMYB558; GSVIVT00002010001; GSVIVT0000667900 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | transcription activator activity | GO:0016563 | Molecular Function | 0.0 | - |
Sma3 | tryptophan biosynthetic process | GO:0000162 | Biological Process | 0.0 | - |
Sma3 | defense response to insect | GO:0002213 | Biological Process | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
Sma3 | response to gibberellin stimulus | GO:0009739 | Biological Process | 0.0 | - |
Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
Sma3 | indole glucosinolate biosynthetic process | GO:0009759 | Biological Process | 0.0 | - |
Sma3 | trichome morphogenesis | GO:0010090 | Biological Process | 0.0 | - |
Sma3 | cellular response to sulfur starvation | GO:0010438 | Biological Process | 0.0 | - |
Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Sma3 | mucilage biosynthetic process involved in seed coat development | GO:0048354 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
Sma3 | Myb-related protein P, C-terminal | IPR010588 | - | 0.0 | - |
Sma3 | IPR012287 | - | 0.0 | - | |
Sma3 | IPR014778 | - | 0.0 | - | |
Sma3 | Myb transcription factor | IPR015495 | - | 0.0 | - |
Sma3 | Myb-like domain | IPR017877 | - | 0.0 | - |
Sma3 | Myb domain, DNA-binding | IPR017930 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G38620.1 | ATMYB4, MYB4 myb domain protein 4 chr4:18053866-18054876 FORWARD LENGTH=282 | 5.0e-22 | 77% |
RefSeq | Arabidopsis thaliana | NP_195574.1 | transcription repressor MYB4 [Arabidopsis thaliana] | 6.0e-22 | 77% |
RefSeq | Populus trichocarpa | XP_002297959.1 | predicted protein [Populus trichocarpa] | 9.0e-25 | 82% |
![]() |
---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LLG1
Fln msg: Distance to subject end: 315 aas, atg_distance in limit (1-15): atg_distance = 11, Unexpected STOP codon in 5 prime region, your sequence is shorter than subject: 63 - 400
Fln protein:
E
Protein Length:
64
Fln nts:
A
Fln Alignment:
G5KS2UX02GEUJF___EDLRLTNYIEAHGEGGWTTLPKKAGLLRCGKSCRLRWMNYLRPDVKRGHILLEEEDLKLRLHR
B8LLG1_______________EDTRLSEYIQSHGESGWRSLPKKAGLNRCGKSCRLRWLNYLRPDIKRGNISPDEEELIIRMHR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain