|
||||||
|
UniGene Name: sp_v3.0_unigene62719
Length: 110 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene62719
T |
|
Ace file of the UniGene sp_v3.0_unigene62719 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | methionine synthase [Carica papaya] | - | - | 2.0e-08 | 88% |
| FL-Next | tr=Vitamin-b12 independent methionine synthase; Pinus pinaster (Maritime pine). | - | - | 0.0 | 97% |
| Sma3 | 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase | - | - | 4.501e-19 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase. | EC:2.1.1.14 | - | 1.829e-32 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cysteine and methionine metabolism | 00270 | 1.829e-32 | % | |
| Sma3 | Selenocompound metabolism | 00450 | 1.829e-32 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 1.829e-32 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.829e-32 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.829e-32 | % |
| Source | Gene names |
|---|---|
| Sma3 | At3g03780; At5g17920; At5g20980; BvMS1; CIMS; ER69; GSVIVT00003836001; GSVIVT00017439001; HvMS; LOC_Os12g42884; MET; METE; MPI7.9; MS1; MS2; MS3; MS4; MS5; Os12g0623900; Os12g0624000; OsI_39179; OsI_39180; OsJ_36927; PHYPADRAFT_205352; PHYPADRAFT_206341; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | peroxisome | GO:0005777 | Cellular Component | 0.0 | - |
| Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase activity | GO:0003871 | Molecular Function | 0.0 | - |
| Sma3 | copper ion binding | GO:0005507 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | methionine synthase activity | GO:0008705 | Molecular Function | 0.0 | - |
| Sma3 | methionine biosynthetic process | GO:0009086 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Methionine synthase, vitamin-B12 independent | IPR002629 | - | 0.0 | - |
| Sma3 | Cobalamin-independent methionine synthase | IPR006276 | - | 0.0 | - |
| Sma3 | Cobalamin (vitamin B12)-independent methionine synthase MetE, N-terminal | IPR013215 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G03780.1 | ATMS2, MS2 methionine synthase 2 chr3:957602-960740 FORWARD LENGTH=765 | 2.0e-11 | 82% |
| RefSeq | Arabidopsis thaliana | NP_187028.1 | methionine synthase 2 [Arabidopsis thaliana] | 3.0e-11 | 82% |
| RefSeq | Populus trichocarpa | XP_002338954.1 | vitamin-b12 independent methionine synthase [Populus trichocarpa] | 1.0e-13 | 88% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: G3C8U7
Fln msg: Distance to subject end: 33 aas, your sequence is shorter than subject: 36 - 766
Fln protein:
Y
Protein Length:
37
Fln nts:
T
Fln Alignment:
G5KS2UX02F7MV9___YDIHSPRIPDTEEIADRIRKLLAVKLETNILWVN
G3C8U7_______________YDIHSPRIPDTEEIADRIRKLLAV-LETNILWVN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
