|
||||||
|
UniGene Name: sp_v3.0_unigene62703
Length: 203 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene62703
A |
|
Ace file of the UniGene sp_v3.0_unigene62703
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Unassigned protein | - | - | 0.0 | - |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 71% |
| Sma3 | Pentatricopeptide repeat-containing protein, putative | - | - | 8.094e-13 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g06140; At1g11290; At1g15510; At1g20230; At2g01510; At2g22070; At2g29760; At3g11460; At3g28640; At3g28660; At4g02750; At4g16470; At4g16835; At4g19191; At4g21300; At5g08510; At5g66520; B1032F05.19; DYW10; F24K9.13; F2I9.13; F8L15.21; FCAALL.374; FCAALL. |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | diacylglycerol kinase activity | GO:0004143 | Molecular Function | 0.0 | - |
| Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
| Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
| Sma3 | activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway | GO:0007205 | Biological Process | 0.0 | - |
| Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
| Sma3 | mRNA modification | GO:0016556 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G66520.1 | Tetratricopeptide repeat (TPR)-like superfamily protein chr5:26551879-26553741 FORWARD LENGTH=620 | 5.0e-23 | 61% |
| RefSeq | Arabidopsis thaliana | NP_201453.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 6.0e-23 | 61% |
| RefSeq | Populus trichocarpa | XP_002302824.1 | predicted protein [Populus trichocarpa] | 5.0e-26 | 69% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ADG9
Fln msg: Distance to subject end: 180 aas, your sequence is shorter than subject: 67 - 312
Fln protein:
C
Protein Length:
68
Fln nts:
A
Fln Alignment:
G5KS2UX02JWFWE___CMSQDYEIIPRMEHYACMVDLLGRAGLLNEARDFIEKMPLKPAADVWGSLLGACRIHCNVKLAETVA
D5ADG9_______________CMTLDYAITPTVEHYACMVDLLGRAGHLNEAWDFIEKMPIEPGASVWGAFLGSCRIHCNIELGERVA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
