UniGene Name: sp_v3.0_unigene62674
Length: 228 nt
UniGene Fasta |
---|
>sp_v3.0_unigene62674
A |
Ace file of the UniGene sp_v3.0_unigene62674 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Leucine-rich repeat receptor protein kinase EXS, putative n=1 Tax=Ricinus communis RepID=B9RWM9_RICCO | - | - | 2.0e-14 | 54% |
FL-Next | tr=Receptor protein kinase; Pinus sylvestris (Scots pine). | - | - | 0.0 | 63% |
Sma3 | Leucine-rich repeat receptor-like protein kinase | - | - | 1.883e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 1.07e-12 | - |
Source | Gene names |
---|---|
Sma3 | AT1G34110; AT1G35710; AT4G26540; AT4g26540; AT5G48940; At1g35710; At3g24240; At5g56040; F12G12.7; F14D7.1; GSVIVT00001242001; GSVIVT00002006001; GSVIVT00005395001; GSVIVT00014274001; GSVIVT00016022001; GSVIVT00017157001; GSVIVT00020456001; GSVIVT000278690 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | interspecies interaction between organisms | GO:0044419 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | Leucine-rich repeat, typical subtype | IPR003591 | - | 0.0 | - |
Sma3 | Aminotransferases, class-I, pyridoxal-phosphate-binding site | IPR004838 | - | 0.0 | - |
Sma3 | Carbamoyl-phosphate synthetase, large subunit, ATP-binding | IPR005479 | - | 0.0 | - |
Sma3 | Tyrosine-protein kinase, active site | IPR008266 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Aldo/keto reductase, conserved site | IPR018170 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G26540.1 | Leucine-rich repeat receptor-like protein kinase family protein chr4:13394673-13398028 REVERSE LENGTH=1091 | 7.0e-18 | 61% |
RefSeq | Arabidopsis thaliana | NP_567748.5 | putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis thaliana] | 1.0e-17 | 61% |
RefSeq | Populus trichocarpa | XP_002304699.1 | predicted protein [Populus trichocarpa] | 4.0e-18 | 65% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q9FEU2
Fln msg: Distance to subject end: 513 aas, your sequence is shorter than subject: 75 - 1145
Fln protein:
C
Protein Length:
76
Fln nts:
A
Fln Alignment:
G5KS2UX02JVJQI___LYIYGNSLSGSLPXXXXXXXXXXXXXXWQNDLVGNIPSELGNCTSLEVLDLSLNGLTGTIPNTIGNLKNLAEL
Q9FEU2_______________LYLYENRLSGAIPRELGKLQKLEKLYLWDNELDGSIPAELGSCSSLKFVDLSTNSLSGSIPDSFGSLKNLSEL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain