UniGene Name: sp_v3.0_unigene62645
Length: 162 nt
![]() |
---|
>sp_v3.0_unigene62645
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative receptor-like protein kinase [Oryza sativa Japonica Group] dbj|BAD09807.1| putative receptor-like protein kinase [Oryza sativa Japonica Group] | - | - | 2.0e-17 | 73% |
FL-Next | tr=Clavata-like receptor; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 60% |
Sma3 | Receptor protein kinase CLAVATA1, putative | - | - | 1.022e-09 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 2.25e-06 | - |
Source | Gene names |
---|---|
Sma3 | 17L07.5; AT1G17750; AT1G34110; AT4G28490; AT4G28650; AT4g00340; A_IG005I10.19; At1g17230; At1g17230/F20D23_7; At1g17750; At1g72180; At1g78530; At2g19130; At4g28490; At4g28650; B1364A02.24; CLAVATA1; CLL1A; CLL2; CLL3; CLL6; F11A6.9; F12G12.7; F20D23.7; F2 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | transmembrane receptor protein kinase activity | GO:0019199 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | protein autophosphorylation | GO:0046777 | Biological Process | 0.0 | - |
Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G73080.1 | PEPR1, ATPEPR1 PEP1 receptor 1 chr1:27484513-27488021 FORWARD LENGTH=1123 | 3.0e-18 | 60% |
RefSeq | Arabidopsis thaliana | NP_177451.1 | leucine-rich repeat receptor-like protein kinase PEPR1 [Arabidopsis thaliana] | 4.0e-18 | 60% |
RefSeq | Populus trichocarpa | XP_002310940.1 | predicted protein [Populus trichocarpa] | 7.0e-22 | 69% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q19AV8
Fln msg: Distance to subject end: 165 aas, your sequence is shorter than subject: 53 - 998
Fln protein:
C
Protein Length:
54
Fln nts:
A
Fln Alignment:
G5KS2UX02GEOXZ___HGMKPPPLLGWDVRYRIAIGTAHGLSYLHHDCRPAIIHRDIKPRNILLDSD
Q19AV8_______________HGPKAS-VLDWPIRYKIALGAAQGLAYLHHGCVPAIVHRDVKSNNILLDED
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain