UniGene Name: sp_v3.0_unigene62573
Length: 230 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene62573
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Peroxisomal acyl-CoA oxidase 1A n=2 Tax=Lycopersicon RepID=Q5D8D1_SOLCE | - | - | 1.0e-31 | 84% |
FL-Next | sp=Acyl-coenzyme A oxidase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 76% |
Sma3 | Acyl-CoA oxidase | - | - | 6.002e-07 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Acyl-CoA oxidase. | EC:1.3.3.6 | - | 1.625e-20 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Fatty acid metabolism | 00071 | 1.625e-20 | % | |
Sma3 | alpha-Linolenic acid metabolism | 00592 | 1.625e-20 | % | |
Sma3 | Biosynthesis of unsaturated fatty acids | 01040 | 1.625e-20 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 1.625e-20 | % | |
Sma3 | Metabolic pathways | 01100 | 1.625e-20 | % |
Source | Gene names |
---|---|
Sma3 | ACX1; ACX1.2; AOX1; AOX1_1; Acx1A; Acx1B; At2g35690; At4g16760; CHLREDRAFT_121379; FCAALL.119; GSVIVT00009514001; MICPUCDRAFT_31340; MICPUN_80126; OSJNBa0075G19.29-1; OSTLU_13743; Os06g0103500; OsI_21277; OsJ_19813; Ot01g02610; PHATRDRAFT_19979; PHYPADRAF |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | peroxisome | GO:0005777 | Cellular Component | 0.0 | - |
Sma3 | acyl-CoA dehydrogenase activity | GO:0003995 | Molecular Function | 0.0 | - |
Sma3 | acyl-CoA oxidase activity | GO:0003997 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
Sma3 | long-chain fatty acid metabolic process | GO:0001676 | Biological Process | 0.0 | - |
Sma3 | fatty acid metabolic process | GO:0006631 | Biological Process | 0.0 | - |
Sma3 | fatty acid beta-oxidation | GO:0006635 | Biological Process | 0.0 | - |
Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Acyl-CoA oxidase, C-terminal | IPR002655 | - | 0.0 | - |
Sma3 | Acyl-CoA oxidase/dehydrogenase, type 1 | IPR006090 | - | 0.0 | - |
Sma3 | Acyl-CoA oxidase/dehydrogenase, central domain | IPR006091 | - | 0.0 | - |
Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
Sma3 | Acyl-CoA oxidase | IPR012258 | - | 0.0 | - |
Sma3 | IPR013764 | - | 0.0 | - | |
Sma3 | Acyl-CoA dehydrogenase/oxidase, N-terminal | IPR013786 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G35690.1 | ACX5 acyl-CoA oxidase 5 chr2:14999962-15002892 FORWARD LENGTH=664 | 2.0e-36 | 76% |
RefSeq | Arabidopsis thaliana | NP_181112.1 | acyl-CoA oxidase [Arabidopsis thaliana] | 2.0e-36 | 76% |
RefSeq | Populus trichocarpa | XP_002326656.1 | predicted protein [Populus trichocarpa] | 4.0e-38 | 79% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NUR5
Fln msg: Distance to subject end: 420 aas, your sequence is shorter than subject: 76 - 660
Fln protein:
S
Protein Length:
77
Fln nts:
T
Fln Alignment:
G5KS2UX02ISPKM___SPTLTSTKWWPGGLGKVSTHAIVYARLITDGQDYG---FIVQIRSLEDHQSLPGVTVADIGMKFGNGAYNTMDNG
A9NUR5_______________SPTLTSTKWWPGGLGKVATHAIVHARLILD-KDYGVHAFIVQIRSLEDHKPLRTITVGDIGQKFGNGGNNTVDNG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain