UniGene Name: sp_v3.0_unigene62561
Length: 237 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene62561
G |
Ace file of the UniGene sp_v3.0_unigene62561 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Retrotransposon protein, putative, unclassified n=1 Tax=Oryza sativa Japonica Group RepID=Q7XEK0_ORYSJ | - | - | 1.0e-18 | 64% |
| FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 51% |
| Sma3 | Retrotransposon protein, putative, unclassified | - | - | 3.636e-10 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g14640; F23H6.1; H0321H01.8; H0502G05.7; LOC_Os03g30360; LOC_Os03g47870; LOC_Os10g28310; LOC_Os10g40890; LOC_Os11g08610; LOC_Os11g26820; LOC_Os12g18080; OSJNBa0004L19.22; OSJNBa0010C11.17; OSJNBa0019J05.12; OSJNBa0026L12.26; OSJNBa0060B20.14; OSJNBb005 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | triglyceride lipase activity | GO:0004806 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | lipid metabolic process | GO:0006629 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
| Sma3 | Legume lectin, alpha chain, conserved site | IPR000985 | - | 0.0 | - |
| Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
| Sma3 | Lipase, class 3 | IPR002921 | - | 0.0 | - |
| Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF834 | IPR008552 | - | 0.0 | - |
| Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
| Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
| Sma3 | Concanavalin A-like lectin/glucanase, subgroup | IPR013320 | - | 0.0 | - |
| Sma3 | Zinc finger, H2C2-type, histone UAS binding | IPR015416 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: A5AVY5
Fln msg: Distance to subject end: 144 aas, your sequence is shorter than subject: 78 - 1412
Fln protein:
Q
Protein Length:
79
Fln nts:
G
Fln Alignment:
G5KS2UX02IWNFZ___QIEVVNKCLETYLRCFVANKQNKWSQWLHLAEWWYNTTYHTSTKMTPFQALYGY*PPRWKDFAVHNSKVQALKNHIEE
A5AVY5_______________QTEVVNRCIETYLRCMVGDNPGQWANWISLAEFWYNTSYHSSLKMSPFEALYGYAPPLQIPYFPKDSNVEAIDRVLNE

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)